IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. Molecular and cellular biology 2012 imex curation Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Accepted 2020-JUN-01 AT 10:52 BST AT 10:52 BST by ORCHARD Molecular and cellular biology 2012 Only protein-protein interactions imex curation imex curation High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. Molecular and cellular biology 2012 imex curation Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Accepted 2020-JUN-01 AT 10:52 BST AT 10:52 BST by ORCHARD Molecular and cellular biology 2012 Only protein-protein interactions imex curation imex curation High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. Molecular and cellular biology 2012 imex curation Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Only protein-protein interactions imex curation human-bewo Homo sapiens bewo Human placenta choriocarcinoma BeWo cell line. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Accepted 2020-JUN-01 AT 10:52 BST AT 10:52 BST by ORCHARD Molecular and cellular biology 2012 Only protein-protein interactions imex curation imex curation High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. Molecular and cellular biology 2012 imex curation Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Only protein-protein interactions imex curation human-bewo Homo sapiens bewo Human placenta choriocarcinoma BeWo cell line. chip-chip chromatin immunoprecipitation array chip-chip primer specific pcr primer specific pcr Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. BeWo31 cells are BeWo cells stably expressing HA-tagged GCM1. hwchen@gate.sinica.edu.tw Accepted 2020-JUN-01 AT 10:52 BST AT 10:52 BST by ORCHARD Molecular and cellular biology 2012 Only protein-protein interactions imex curation imex curation High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. High-temperature requirement protein A4 (HtrA4) suppresses the fusogenic activity of syncytin-1 and promotes trophoblast invasion. Molecular and cellular biology 2012 imex curation Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang LJ., Cheong ML., Lee YS., Lee MT., Chen H. Results from Figure 4C (proteolysis of Fibronectin by HtrA4) have not been entered as the species origin and expression system for Fibronectin cannot be determined. Calbio have both bovine and human FN - and it is her described as "recombinant" - nothing of this description to be found. hwchen@gate.sinica.edu.tw Accepted 2020-JUN-01 AT 10:52 BST AT 10:52 BST by ORCHARD Molecular and cellular biology 2012 Only protein-protein interactions imex curation imex curation q9uqf0-pro_0000008486 Surface protein ERVW-1 ERVWE1 Endogenous retrovirus group W member 1 Env-W Envelope polyprotein gPr73 Enverin HERV-7q Envelope protein HERV-W envelope protein HERV-W_7q21.2 provirus ancestral Env polyprotein Syncytin protein protein human Homo sapiens Human APPPCRCMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSATLCMHANTHYWTGKMINPSCPGGLGVTVCWTYFTQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINTTSVLVGPLVSNLEITHTSNLTCVKFSNTTYTTNSQCIRWVTPPTQIVCLPSGIFFVCGTSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKR 21 317 BE7D52A138869162 htra4_human Serine protease HTRA4 High-temperature requirement factor A4 HTRA4 protein protein human Homo sapiens Human MIRPQLRTAGLGRCLLPGLLLLLVPVLWAGAEKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCRVCPAAEREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETIN htra4_human_gene Serine protease HTRA4 HTRA4 gene gene human Homo sapiens Human plgf_human_gene Placenta growth factor PGF PGFL PLGF gene gene human Homo sapiens Human gcm1_human Chorion-specific transcription factor GCMa GCM1 GCMA GCM motif protein 1 Glial cells missing homolog 1 protein protein human Homo sapiens Human MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEARRAMKKVNTAPSSVSLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR E16CDD2DDEB25678 gcm1-htra4-1 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr8:38973801-38973821 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1D Binding was also observed to the promoter region of the PGF gene (Placenta growth factor). htra4-gcm1-1 5 8 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr8:38973801-38973821 region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NC_000008.11:g.38973979_38973984delinsAACTAC mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey purified purified C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 2E, Lane 2 + 4 htra4-gcm1-2 5 8 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey purified purified C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 competitor competitor competitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2E, Lane 5 htra4-gcm1-3 1 8 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr8:38973801-38973821 region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NC_000008.11:g.38973979_38973984delinsAACTAC mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey purified purified C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 2E, Lane 3 gcm1-pgf-1 3 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1D No sequences are stated for the promoter region. as there is no sequence I am not sure if we are meant to curate this - but Manual does not say we cannot. gcm1-htra4-3 3 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr8:38973801-38973821 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2E ervw_1-htra4-1 2 7 unspecified role unspecified role prey prey purified purified C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P83105:p.Ser326Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:58:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser326Ala' PDZ_domain binding region binding-associated region binding region range range range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 6D