UniProt UniProt http://www.uniprot.org Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. I have not included the CRP-GPCR43 as the Y3H data showed this was indirect. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms predetermined predetermined participant predetermined Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. NO I have not included the CRP-GPCR43 as the Y3H data showed this was indirect. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT human leukocyte cDNA library Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Secreted M-ficolin anchors onto monocyte transmembrane G protein-coupled receptor 43 and cross talks with plasma C-reactive protein to mediate immune signaling and regulate host defense. Journal of immunology (Baltimore, Md. : 1950) 2010 imex curation Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL., Zhang J., Yang L., Ang Z., Yoong SL., Tran TT., Anand GS., Tan NS., Ho B., Ding JL. Source of m-ficolin taken from PMID:21689722 which refers back to this publication, source of CRP from peptide mapping. dbsdjl@nus.edu.sg Accepted 2020-OCT-26 AT 11:06 GMT AT 11:06 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2010 Only protein-protein interactions imex curation imex curation fshr_human Follicle-stimulating hormone receptor Follitropin receptor FSHR LGR1 protein protein human Homo sapiens Human MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN 766BC421014CD5A4 cof1_human Cofilin-1 CFL1 CFL Cofilin, non-muscle isoform 18 kDa phosphoprotein protein protein human Homo sapiens Human MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL DIP protein P23528 original sequence version: 124 DIP protein P23528 original sequence version: 172 589EF8FC1EC13719 o00602-pro_0000009136 Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human ADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 30 326 D0F7BFDD52C155A9 arl4a_human ADP-ribosylation factor-like protein 4A ARL4A ARL4 protein protein human Homo sapiens Human MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR 8D93A8C003BD16CF ma2b1_human Lysosomal alpha-mannosidase MAN2B1 LAMAN MANB Lysosomal acid alpha-mannosidase Mannosidase alpha class 2B member 1 Mannosidase alpha-B protein protein human Homo sapiens Human MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARLRGFKDHFTFCQQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRGRHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG E11C77C19D8BD88C zxdc_human Zinc finger protein ZXDC ZXDC ZXDL ZXD-like zinc finger protein protein protein human Homo sapiens Human MDLPALLPAPTARGGQHGGGPGPLRRAPAPLGASPARRRLLLVRGPEDGGPGARPGEASGPSPPPAEDDSDGDSFLVLLEVPHGGAAAEAAGSQEAEPGSRVNLASRPEQGPSGPAAPPGPGVAPAGAVTISSQDLLVRLDRGVLALSAPPGPATAGAAAPRRAPQASGPSTPGYRCPEPQCALAFAKKHQLKVHLLTHGGGQGRRPFKCPLEGCGWAFTTSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFICDSDSCGWTFTSMSKLLRHRRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFECPVEGCCARFSARSSLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQDLLPQLEAPSSLTPSSELSSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTIDVTSVSSSLGGNLPANNSSLGPMEPLVLVAHSDIPPSLDSPLVLGTAATVLQQGSFSVDDVQTVSAGALGCLVALPMKNLSDDPLALTSNSNLAAHITTPTSSSTPRENASVPELLAPIKVEPDSPSRPGAVGQQEGSHGLPQSTLPSPAEQHGAQDTELSAGTGNFYLESGGSARTDYRAIQLAKEKKQRGAGSNAGASQSTQRKIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLPVYVLQEVLPSSGGPAGPEATQFPGSTINLQDLQ 8C35F5685CF1E695 midn_human Midnolin MIDN Midbrain nucleolar protein protein protein human Homo sapiens Human MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA May be involved in regulation of genes related to neurogenesis in the nucleolus mint homomint E4086F3B6E16C4C2 cc88b_human Coiled-coil domain-containing protein 88B CCDC88B BRLZ Brain leucine zipper domain-containing protein Hook-related protein 3 Gipie protein protein human Homo sapiens Human MEGGKGPRLRDFLSGSLATWALGLAGLVGEAEDSEGEEEEEEEEPPLWLEKRFLRLSDGALLLRVLGIIAPSSRGGPRMLRGLDGPAAWRVWNLNHLWGRLRDFYQEELQLLILSPPPDLQTLGFDPLSEEAVEQLEGVLRLLLGASVQCEHRELFIRHIQGLSLEVQSELAAAIQEVTQPGAGVVLALSGPDPGELAPAELEMLSRSLMGTLSKLARERDLGAQRLAELLLEREPLCLRPEAPSRAPAEGPSHHLALQLANAKAQLRRLRQELEEKAELLLDSQAEVQGLEAEIRRLRQEAQALSGQAKRAELYREEAEALRERAGRLPRLQEELRRCRERLQAAEAYKSQLEEERVLSGVLEASKALLEEQLEAARERCARLHETQRENLLLRTRLGEAHAELDSLRHQVDQLAEENVELELELQRSLEPPPGSPGEAPLAGAAPSLQDEVREAEAGRLRTLERENRELRGLLQVLQGQPGGQHPLLEAPREDPVLPVLEEAPQTPVAFDHSPQGLVQKARDGGPQALDLAPPALDSVLEASAECPQAPDSDPQEAESPLQAAAMDPQASDWSPQESGSPVETQESPEKAGRRSSLQSPASVAPPQGPGTKIQAPQLLGGETEGREAPQGELVPEAWGLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQARRAEAEAHREAEAQAWEQARLREAVEAAGQELESASQEREALVEALAAAGRERRQWEREGSRLRAQSEAAEERMQVLESEGRQHLEEAERERREKEALQAELEKAVVRGKELGDRLEHLQRELEQAALERQEFLREKESQHQRYQGLEQRLEAELQAAATSKEEALMELKTRALQLEEELFQLRQGPAGLGPKKRAEPQLVETQNVRLIEVERSNAMLVAEKAALQGQLQHLEGQLGSLQGRAQELLLQSQRAQEHSSRLQAEKSVLEIQGQELHRKLEVLEEEVRAARQSQEETRGQQQALLRDHKALAQLQRRQEAELEGLLVRHRDLKANMRALELAHRELQGRHEQLQAQRASVEAQEVALLAERERLMQDGHRQRGLEEELRRLQSEHDRAQMLLAELSRERGELQGERGELRGRLARLELERAQLEMQSQQLRESNQQLDLSACRLTTQCELLTQLRSAQEEENRQLLAEVQALSRENRELLERSLESRDHLHREQREYLDQLNALRREKQKLVEKIMDQYRVLEPVPLPRTKKGSWLADKVKRLMRPRREGGPPGGLRLGADGAGSTESLGGPPETELPEGREADGTGSPSPAPMRRAQSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVGWENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ 4DB82F199F224EFC tnfc_human Lymphotoxin-beta Tumor necrosis factor C Tumor necrosis factor ligand superfamily member 3 LTB TNFC TNFSF3 protein protein human Homo sapiens Human MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG F41569459830ED4C albu_bovin Albumin ALB BSA protein protein bovin Bos taurus (Bovine) Bovine MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA 39167DFE768585D4 mmp25_human Matrix metalloproteinase-25 MMP25 Leukolysin MMP20 MMPL1 MT6MMP Membrane-type matrix metalloproteinase 6 Membrane-type-6 matrix metalloproteinase protein protein human Homo sapiens Human MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRDAIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAAGRWPAPIPLLLLPLLVGGVASR A6A50AE05D969C64 saraf_human Store-operated calcium entry-associated regulatory factor SARAF HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 TMEM66 Transmembrane protein 66 XTP3 HSPC035 NPD003 PSEC0019 UNQ1967/PRO4499 protein protein human Homo sapiens Human MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR 83CC0517AB635FE9 kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB ccs_human Copper chaperone for superoxide dismutase CCS Superoxide dismutase copper chaperone protein protein human Homo sapiens Human MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL A392432954B65760 gran_human Grancalcin GCA GCL protein protein human Homo sapiens Human MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI 88CA4DDF835AFFE4 88CA4DDF835AFFE4 wdr6_human WD repeat-containing protein 6 WDR6 protein protein human Homo sapiens Human MDALEDYVWPRATSELILLPVTGLECVGDRLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCILQEVPCTDRCTLSSACLIGDAWKELTIVAGAVSNQLLVWYPATALADNKPVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKVGDLRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGIRAIAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYLYDVEVKCWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGRVKVVPINTPTAAVDQTLFPGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKERCRYLLPPSKQRWHTCSAFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKARAGAGAPVVGSGSSGGGNAFTGLGPVSTLPSLHGKQGVTSVTCHGGYVYTTGRDGAYYQLFVRDGQLQPVLRQKSCRGMNWLAGLRIVPDGSMVILGFHANEFVVWNPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFAYLKDGDVMLYRALGGCTRPHVILREGLHGREITCVKRVGTITLGPEYGVPSFMQPDDLEPGSEGPDLTDIVITCSEDTTVCVLALPTTTGSAHALTAVCNHISSVRAVAVWGIGTPGGPQDPQPGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLACHVMHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD 4E408D5D893FF005 mbtp1_human Membrane-bound transcription factor site-1 protease MBTPS1 KIAA0091 S1P SKI1 Endopeptidase S1P Subtilisin/kexin-isozyme 1 protein protein human Homo sapiens Human MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAESDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVVAGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGRIVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV CA6F013588595B45 fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 asxl1_human Polycomb group protein ASXL1 ASXL1 KIAA0978 Additional sex combs-like protein 1 protein protein human Homo sapiens Human MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVSGENDVSLDETSSNASCSTESQSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVNGAHVESASGFSGCHADGESGSPSSSSSGSLALGSAAIRGQAEVTQDPAPLLRGFRKPATGQMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHFQQQLLFLLPEVDRQVGTDGLLRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQWKEKFFEDYYGQKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRARRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPEFPVESVASRIQAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKPRLEDRQSFRNTIESVHTEKPQPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPTTESSCRGWTGARTLADIKARALQVRGARGHHCHREAATTAIGGGGGPGGGGGGATDEGGGRGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPYPLNGEHTQAGTAMSRARREDLPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTSVAERLVEQPQLHPDVRTECESGTTSWESDDEEQGPTVPADNGPIPSLVGDDTLEKGTGQALDSHPTMKDPVNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIPIPSNDEVVKQPKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLWTVPSRGGSDSNGSYCQQVDIEKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTREAAVTKGSSVDKDEKPNWNQSAPLSKVNGDMRLVTRTDGMVAPQSWVSRVCAVRQKIPDSLLLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEKVLPPAHDDSMSESPQVPLTKDQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLARIEATQAPGAPQKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPGKSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPADPMPLPAEIPPVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKANAENRKATGHSPLELVGHLEGMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAFYGKLSKLQLSSTSFNYSSSSPTFPKGLAGSVVQLSHKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR DIP protein Q8IXJ9 original sequence version: 71 DIP protein Q8IXJ9 original sequence version: 91 8FCE072F3295AA34 s10a9_human Protein S100-A9 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain Calprotectin L1H subunit S100A9 CAGB CFAG MRP14 protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP C3BE19729E14C078 zyx_human Zyxin Zyxin-2 ZYX protein protein human Homo sapiens Human MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT 2833B1EFA260B762 hcst_human Hematopoietic cell signal transducer DAP10 KAP10 PIK3AP DNAX-activation protein 10 Membrane protein DAP10 Transmembrane adapter protein KAP10 UNQ587/PRO1157 HCST protein protein human Homo sapiens Human MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG 97786F24F8A2EE44 ffar2_human Free fatty acid receptor 2 FFAR2 GPR43 G-protein coupled receptor 43 FFA2 GPCR43 protein protein human Homo sapiens Human MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE F4A8AC6AFBDF1E90 emil2_human EMILIN-2 EMILIN2 Elastin microfibril interface-located protein 2 Protein FOAP-10 protein protein human Homo sapiens Human MWQPRRPWPRVPWRWALALLALVGAGLCHAGPQPGYPARPSARNKNWCAYIVNKNVSCSVLEGSESFIQAQYNCAWNQMPCPSALVYRVNFRPRYVTRYKTVTQLEWRCCPGFRGGDCQEGPKDPVKTLRPTPARPRNSLKKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEGPQELQEKKIQVLEEKVLRLTRTVLDLQSSLAGVSENLKHATQDDASRTRAPGLSSQHPKPDTTVSGDTETGQSPGVFNTKESGMKDIKSELAEVKDTLKNKSDKLEELDGKVKGYEGQLRQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLTGLQQQCDDYGSSYLGVIELIGEKETSLRKEINNLRARLQEPSAQANCCDSEKNGDIGQQIKTLDQKIERVAEATRMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNTGAELSPPGAAALPGVSGSGDERVMMELNHLKDKVQVVEDICLLNIQGKPHGMEGALPNREDRAVRDSLHLLKSLNDTMHRKFQETEQTIQKLQQDFSFLYSQLNHTENDVTHLQKEMSNCRAGENAGMGRFTKVGEQERTVDTLPSPQHPVAHCCSQLEERWQRLQSQVISELDACKECTQGVQREVSMVEGRVSHMEKTCSKLDSISGNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDLVKFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPGSTGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGAPVPSLVSFSAGLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQLHTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAVNVVVTGGKLAHTDFDEMYSTFSGVFLYPFLSHL 9F2895AB0AC5E8EF pvrig_human Transmembrane protein PVRIG CD112 receptor Poliovirus receptor-related immunoglobulin domain-containing protein PVRIG C7orf15 protein protein human Homo sapiens Human MRTEAQVPALQPPEPGLEGAMGHRTLVLPWVLLTLCVTAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPNGAGGTTLAVLHPERGIRQWAPARQARWETQSSISLILEGSGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCVYLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWASLPTHAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 184D24B371B251AB mt2_human Metallothionein-2 Metallothionein-II Metallothionein-2A MT2A CES1 MT2 protein protein human Homo sapiens Human MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA 7B0A7E1F99843078 gdir2_human Rho GDP-dissociation inhibitor 2 GDIA2 GDID4 RAP1GN1 Ly-GDI Rho-GDI beta ARHGDIB protein protein human Homo sapiens Human MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE DIP protein P52566 original sequence version: 104 F1E840134F643E5F sen34_human tRNA-splicing endonuclease subunit Sen34 TSEN34 LENG5 Leukocyte receptor cluster member 5 SEN34 tRNA-intron endonuclease Sen34 protein protein human Homo sapiens Human MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQPDGKVVYTSLQWASLQ 1C1522D030148EC3 in35_human Interferon-induced 35 kDa protein IFI35 IFP35 protein protein human Homo sapiens Human MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG 3FCAB26E97317508 i27l2_human Interferon alpha-inducible protein 27-like protein 2 IFI27L2 FAM14A TLH29 Interferon-stimulated gene 12b protein Protein TLH29 pIFI27-like protein protein protein human Homo sapiens Human MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAGLSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE C7283B34AE64CD87 crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 igha1_human Immunoglobulin heavy constant alpha 1 IGHA1 Ig alpha-1 chain C region Ig alpha-1 chain C region BUR Ig alpha-1 chain C region TRO protein protein human Homo sapiens Human ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY EBA11ECB7E85DB21 pdli5_human PDZ and LIM domain protein 5 Enigma homolog Enigma-like PDZ and LIM domains protein PDLIM5 L9 ENH protein protein human Homo sapiens Human MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQRASAAPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTSTNNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLHANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQGDSKQQNGPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF DIP protein Q96HC4 original sequence version: 128 BBEAB9EDFA060736 echb_human Trifunctional enzyme subunit beta, mitochondrial HADHB MSTP029 TP-beta protein protein human Homo sapiens Human MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK DIP protein P55084 original sequence version: null A7B41C37BEC1E6AD stk24_human Serine/threonine-protein kinase 24 STK24 MST3 STK3 STE20-like kinase MST3 Mammalian STE20-like protein kinase 3 protein protein human Homo sapiens Human MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH DIP protein Q9Y6E0 original sequence version: 130 DIP protein Q9Y6E0 original sequence version: 146 4A9FF1F6B6A88A97 fcn1-emilin2-1 7 33 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ffar2-1 7 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-fcn1-1 7 35 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ifi35-1 7 39 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ccs-1 7 23 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-man2b1-1 7 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-gca-1 7 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-hadhb-1 7 44 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-asxl1-1 7 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-pvrig-1 7 34 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-stk24-1 7 45 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-fshr-1 7 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-zxdc-1 7 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-arhgdib-1 7 37 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-wdr6-1 7 25 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-arl4a-1 7 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-midn-1 7 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ccdc88b-1 7 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-cfl1-1 7 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-s100a9-1 7 29 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-prkaca-1 7 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-zyx-1 7 30 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-saraf-1 7 21 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-mbtps1-1 7 26 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-pdlim5-1 7 43 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ifi27l2-1 7 40 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-hcst-1 7 31 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-mt2a-1 7 36 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-ltb-1 7 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-emilin2-2 1 33 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2A fcn1-mmp25-1 7 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-mmp25-2 1 20 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig.2A fcn1-ffar2-2 1 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2 A/B fcn1-ifi35-2 1 39 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2A fcn1-ffar2-3 9 32 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 2C, Supp.FIg. 1A fcn1-ffar2-4 5 32 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction Fig. 2D, Supp.FIg. 1B fcn1-ffar2-5 1 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed fbg sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2E fcn1-ffar2-6 1 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2E fcn1-ffar2-7 2 32 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 35 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 2D, 5B, Supp.FIg. 1B Interaction was not pH dependent crp-fcn1-1 8 41 unspecified role unspecified role bait bait purified purified 35 unspecified role unspecified role prey prey purified purified human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Fig. 5A Binding is stronger at pH6.5 than 7.4 crp-fcn1-2 2 41 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 35 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 5B fcn1-ffar2-8 6 41 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 32 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed physical association physical association Supp.Fig. 4B crp-fcn1-3 3 41 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35 unspecified role unspecified role neutral component neutral component purified purified human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Supp. Fig. 6 Binding is stronger at pH6.5 than 7.4 crp-fcn1-4 3 41 unspecified role unspecified role neutral component neutral component purified purified 35 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Supp. Fig. 5 Binding is stronger at pH6.5 than 7.4 ffar2-fcn2-1 1 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 32 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp. Fig. 8 fcn1-tsen34-1 7 38 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 fcn1-igha1-1 7 42 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp Table 1 ffar2-fcn1-1 1 32 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 2B, Supp. Fig. 8 crp-ffar2-1 4 41 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 32 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 5B fcn1-alb-1 8 12 unspecified role unspecified role bait bait purified purified fbg sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 19 unspecified role unspecified role prey prey purified purified N-acetylglucosamine nacres mono N-acetylated residue N-Acetyl N-Acetylation NAcRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum direct interaction direct interaction Fig. 6C fcn1-alb-2 8 41 competitor competitor competitor unspecified role unspecified role purified purified 12 unspecified role unspecified role bait bait purified purified fbg sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 19 unspecified role unspecified role prey prey purified purified N-acetylglucosamine nacres mono N-acetylated residue N-Acetyl N-Acetylation NAcRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bovin-serum Bovine serum serum Serum direct interaction direct interaction Fig. 6C