IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm. Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm. Structure (London, England : 1993) 2003 imex curation Kang BS., Cooper DR., Devedjiev Y., Derewenda U., Derewenda ZS. zsd4n@virginia.edu 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kang BS., Cooper DR., Devedjiev Y., Derewenda U., Derewenda ZS. zsd4n@virginia.edu Accepted 2020-SEP-28 AT 10:24 BST AT 10:24 BST by PPORRAS Structure (London, England : 1993) 2003 Only protein-protein interactions imex curation imex curation il5ra_human Interleukin-5 receptor subunit alpha IL5RA IL5R CDw125 protein protein human Homo sapiens Human MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSLICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF 4E0A5F2838B9C4FE sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV DIP protein O00560 original sequence version: 87 DIP protein O00560-1 original sequence version: 117 574E1349F86F949F sdc4_human Syndecan-4 SDC4 Amphiglycan Ryudocan core protein protein protein human Homo sapiens Human MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA DIP protein P31431 original sequence version: 87 DIP protein P31431-1 original sequence version: 134 8229AA2733F77A10 sdc4-sdcbp-2 1 4 unspecified role unspecified role neutral component neutral component purified purified Syndecan-4 c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified PDZ2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 9 7 direct interaction direct interaction Fig. 1a, 1b 1.85 17.5/22.6 il5ra-sdcbp-1 1 2 unspecified role unspecified role neutral component neutral component purified purified IL5RA c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified PDZ2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 14 12 direct interaction direct interaction Fig. 1c, 1d 1.35 17.6/21.2 il5ra-sdcbp-2 1 2 unspecified role unspecified role neutral component neutral component purified purified IL5RA c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified PDZ tandem sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 17 19 direct interaction direct interaction 1.7 14.8/21.3 not shown