UniProt UniProt http://www.uniprot.org Cloning, tissue expression pattern, and chromosome location of a novel human gene BRI3BP. Cloning, tissue expression pattern, and chromosome location of a novel human gene BRI3BP. Biochemical genetics 2001 imex curation Lin L., Wu Y., Li C., Zhao S. cbli@fudan.ac.cn Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin L., Wu Y., Li C., Zhao S. cbli@fudan.ac.cn Accepted 2020-JUL-02 AT 12:13 BST AT 12:13 BST by LUANA human fetal brain cDNA Biochemical genetics 2001 Only protein-protein interactions imex curation imex curation bri3_human Brain protein I3 BRI3 pRGR2 protein protein human Homo sapiens Human MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA ABBFADD00E91C52C bri3b_human BRI3-binding protein BRI3BP KG19 Cervical cancer 1 proto-oncogene-binding protein KG19 HCCRBP-1 protein protein human Homo sapiens Human MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK DBC7ECB411010F71 bri3-bri3bp-3 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association