IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Re-refinement using reprocessed data to improve the quality of the structure: a case study involving garlic lectin. Re-refinement using reprocessed data to improve the quality of the structure: a case study involving garlic lectin. Acta crystallographica. Section D, Biological crystallography 2002 imex curation Ramachandraiah G., Chandra NR., Surolia A., Vijayan M. mv@mbu.iisc.ernet.in Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ramachandraiah G., Chandra NR., Surolia A., Vijayan M. mv@mbu.iisc.ernet.in Accepted 2020-JUN-17 AT 16:58 BST AT 16:58 BST by PPORRAS Acta crystallographica. Section D, Biological crystallography 2002 Only protein-protein interactions imex curation imex curation q38783_allsa ASAII1 protein protein allsa Allium sativum RMTTPSPKVMSIATVAAILTIWASTCMARNILMNDEGLYAGQSLDVEPYHLIMQEDCNLVLYDHSTAVWTSNTDIPGKKGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIYGSDIWSTNTYKGSARGPVIRKVGTLAGAA C23D067189B2A6B4 q38789_allsa LECASAI3 protein protein allsa Allium sativum TTSSPKLMSIATVAAILTILASTCMARNLLTNGEGLYAGQSLNVEPYHFIMQEDCNLVLYDHSTAVWATNTDIPGKKECRAVLQSDGNFVVYDADGRPLWASHSVRGNGNYVLVLQEDGNVVIYGSDIWSTGTYVKAARGPVVVAMNGTVDGGSLIRPVIVNKNHVPVIRKVGTLSRNILRNDEGLYAGQSLDVEPYHFIMQEDCNLVLYDHSTAVWASNTDIPGKKGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIYGSDIWSTDTYRKSARGPVIRKVGTLAGAA EC4BF2A107163282 asaii1-lecasai3-1 1 2 unspecified role unspecified role neutral component neutral component purified purified Bulb-type lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain allsa Allium sativum 3 unspecified role unspecified role neutral component neutral component purified purified Bulb-type lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain allsa Allium sativum 6 8 direct interaction direct interaction Fig. 6 2.2 21.1/25.1