IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD147 facilitates HIV-1 infection by interacting with virus-associated cyclophilin A. CD147 facilitates HIV-1 infection by interacting with virus-associated cyclophilin A. Proceedings of the National Academy of Sciences of the United States of America 2001 imex curation Pushkarsky T., Zybarth G., Dubrovsky L., Yurchenko V., Tang H., Guo H., Toole B., Sherry B., Bukrinsky M. Virus - Publications including interactions involving viral proteins mbukrinsky@picower.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pushkarsky T., Zybarth G., Dubrovsky L., Yurchenko V., Tang H., Guo H., Toole B., Sherry B., Bukrinsky M. Virus - Publications including interactions involving viral proteins Phytohemagglutinin-activated PBMC cultures. mbukrinsky@picower.edu Accepted 2020-JUL-30 AT 11:07 BST AT 11:07 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2001 Only protein-protein interactions imex curation imex curation ppia_human Peptidyl-prolyl cis-trans isomerase A Cyclophilin A Cyclosporin A-binding protein PPIA CYPA Rotamase A protein protein human Homo sapiens Human MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE DIP protein P62937 original sequence version: 81 DIP protein P62937-1 original sequence version: 141 9B2E637A555E4434 basi_human Basigin Leukocyte activation antigen M6 Collagenase stimulatory factor Extracellular matrix metalloproteinase inducer 5F7 Tumor cell-derived collagenase stimulatory factor OK blood group antigen BSG UNQ6505/PRO21383 Hepatoma-associated antigen protein protein human Homo sapiens Human MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS D74C37455BF26685 bsg-ppia-2 1 2 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2 low temperature (4 degrees C) Cyclosporin A (CHEBI:4031) Interaction was observed under HIV-1 infection.