IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apert syndrome mutations in fibroblast growth factor receptor 2 exhibit increased affinity for FGF ligand. Apert syndrome mutations in fibroblast growth factor receptor 2 exhibit increased affinity for FGF ligand. Human molecular genetics 1998 imex curation Anderson J., Burns HD., Enriquez-Harris P., Wilkie AO., Heath JK. Rare diseases - Interactions investigated in the context of Rare genetic disease j.k.heath@bham.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Anderson J., Burns HD., Enriquez-Harris P., Wilkie AO., Heath JK. Rare diseases - Interactions investigated in the context of Rare genetic disease j.k.heath@bham.ac.uk Accepted 2019-DEC-05 AT 10:31 GMT AT 10:31 GMT by ORCHARD Human molecular genetics 1998 Only protein-protein interactions imex curation imex curation Apert syndrome mutations in fibroblast growth factor receptor 2 exhibit increased affinity for FGF ligand. Apert syndrome mutations in fibroblast growth factor receptor 2 exhibit increased affinity for FGF ligand. Human molecular genetics 1998 imex curation Anderson J., Burns HD., Enriquez-Harris P., Wilkie AO., Heath JK. Rare diseases - Interactions investigated in the context of Rare genetic disease j.k.heath@bham.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bn-page blue native page bn-page edman degradation edman degradation Anderson J., Burns HD., Enriquez-Harris P., Wilkie AO., Heath JK. Rare diseases - Interactions investigated in the context of Rare genetic disease j.k.heath@bham.ac.uk Accepted 2019-DEC-05 AT 10:31 GMT AT 10:31 GMT by ORCHARD Human molecular genetics 1998 Only protein-protein interactions imex curation imex curation fgf1_human Fibroblast growth factor 1 Acidic fibroblast growth factor FGF1 FGFA Heparin-binding growth factor 1 Endothelial cell growth factor protein protein human Homo sapiens Human MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD F586E8BFB09F1580 fgf4_human Fibroblast growth factor 4 FGF4 HST HSTF1 KS3 Heparin secretory-transforming protein 1 Heparin-binding growth factor 4 Transforming protein KS3 protein protein human Homo sapiens Human MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL C7FD54A0272A1569 fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 p21802-1 Fibroblast growth factor receptor 2 K-sam Keratinocyte growth factor receptor BEK FGFR2IIIc FGFR2 BEK KGFR KSAM protein protein human Homo sapiens Human MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT DIP protein P21802-1 original sequence version: 205 DIP protein P21802-1 original sequence version: 149 DIP protein P21802 original sequence version: 163 DIP protein P21802-1 original sequence version: 189 DIP protein P21802 original sequence version: 189 DIP protein P21802-1 original sequence version: 186 fgf2-fgfr2-8 2 5 unspecified role unspecified role neutral component neutral component purified purified 6 unspecified role unspecified role neutral component neutral component purified purified P21802-1:p.Ser252Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S W Tue Jun 30 15:35:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Trp' P21802-1:p.Pro253Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P R Tue Jun 30 16:29:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro253Arg' P21802-1:p.Ser267Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S P Tue Jun 30 17:30:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser267Pro' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 2 fgf2-fgfr2-9 1 5 unspecified role unspecified role prey prey purified purified 6 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P21802-1:p.Ser252Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S W Tue Jun 30 16:53:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Trp' P21802-1:p.Pro253Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P R Tue Jun 30 16:31:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro253Arg' P21802-1:p.Ser252Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S L Tue Jun 30 18:19:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Leu' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 3, 4, Table 1, Fig. 6 fgf1-fgfr2-11 1 3 unspecified role unspecified role prey prey purified purified 6 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P21802-1:p.Ser252Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S W Tue Jun 30 15:48:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Trp' P21802-1:p.Pro253Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P R Tue Jun 30 16:02:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro253Arg' direct interaction direct interaction Fig. 5a, 5b, Table 1 fgfr2-fgf4-1 1 4 unspecified role unspecified role prey prey purified purified 6 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P21802-1:p.Ser252Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S W Tue Jun 30 17:28:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser252Trp' P21802-1:p.Pro253Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P R Tue Jun 30 18:03:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro253Arg' direct interaction direct interaction Fig. 5, Table 1 fgfr2-fgfr2-4 2 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 2