DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Marine Proteobacteria metabolize glycolate via the β-hydroxyaspartate cycle. Marine Proteobacteria metabolize glycolate via the β-hydroxyaspartate cycle. Nature 2019 imex curation Schada von Borzyskowski L., Severi F., Krüger K., Hermann L., Gilardet A., Sippel F., Pommerenke B., Claus P., Cortina NS., Glatter T., Zauner S., Zarzycki J., Fuchs BM., Bremer E., Maier UG., Amann RI., Erb TJ. schada@mpi-marburg.mpg.de; toerb@mpi-marburg.mpg.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Schada von Borzyskowski L., Severi F., Krüger K., Hermann L., Gilardet A., Sippel F., Pommerenke B., Claus P., Cortina NS., Glatter T., Zauner S., Zarzycki J., Fuchs BM., Bremer E., Maier UG., Amann RI., Erb TJ. schada@mpi-marburg.mpg.de; toerb@mpi-marburg.mpg.de Accepted 2020-JAN-13 AT 14:12 GMT AT 14:12 GMT by MGT Nature 2019 Only protein-protein interactions imex curation imex curation bhcd_pardp Iminosuccinate reductase bhcD Pden_3918 protein protein pardp Paracoccus denitrificans (strain Pd 1222) MLVVAEKEIAGLMTPEAAFEAIEAVFASMARRKAYNFPVVREAIGHEDALYGFKGGFDASALVLGLKAGGYWPNNQKHNLINHQSTVFLFDPDTGRVSAAVGGNLLTALRTAAASAVSIKYLAPKGAKVLGMIGAGHQSAFQMRAAANVHRFEKVIGWNPHPEMLSRLADTAAELGLPFEAVELDRLGAEADVIVSITSSFSPLLMNEHVKGPTHIAAMGTDTKGKQELDPALVARARIFTDEVAQSVSIGECQHAIAAGLIREDQVGELGAVVAGDDPGRGDAEVTIFDGTGVGLQDLAVAQAVVELAKHKGVAQEVEI 4CD6659C20328BAD bhcc_pardp 3-hydroxy-D-aspartate aldolase bhcC beta-hydroxyaspartate aldolase Pden_3919 protein protein pardp Paracoccus denitrificans (strain Pd 1222) MNAKTDFSGYEVGYDIPALPGMDESEIQTPCLILDLDALERNIRKMGDYAKAHGMRHRSHGKMHKSVDVQKLQESLGGSVGVCCQKVSEAEAFARGGIKDVLVTNEVREPAKIDRLARLPKTGATVTVCVDDVQNIADLSAAAQKHGTELGIFVEIDCGAGRCGVTTKEAVVEIAKAAAAAPNLTFKGIQAYQGAMQHMDSFEDRKAKLDAAIAQVKEAVDALEAEGLAPEFVSGGGTGSYYFESNSGIYNELQCGSYAFMDADYGRIHDAEGKRIDQGEWENALFILTSVMSHAKPHLAVVDAGLKAQSVDSGLPFVYGRDDVKYIKCSDEHGVVEDKDGVLKVNDKLRLVPGHCDPTCNVHDWYVGVRNGKVETVWPVSARGKGY 831CE7FF51A8F0CA a1b8z1_pardp-1 1 3 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Extended Data Table 1 a1b8z0_pardp-1 1 2 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Extended Data Table 1