IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Molecular systems biology 2019 imex curation Diether M., Nikolaev Y., Allain FH., Sauer U. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr structure determination identification by structure determination identification by structure determination structure determination Diether M., Nikolaev Y., Allain FH., Sauer U. The authors used a Relaxation Factor cut-off of 0.1805 to define bona-fide protein-metabolite interactions. The cut-off was defined by using a set of reference known interactions and selecting the value that yielded a false-positive rate of 5%. Pools of 12-15 metabolites were tested against each purified protein and the identity of the bound ones was ascertained by solving the structure of the metabolite-protein complex. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Accepted 2019-DEC-05 AT 10:20 GMT AT 10:20 GMT by ORCHARD Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Molecular systems biology 2019 imex curation Diether M., Nikolaev Y., Allain FH., Sauer U. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. Enzymatic in vitro assays for Zwf were performed by measuring the formation of NADPH photometrically at 340 nm. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Accepted 2019-DEC-05 AT 10:20 GMT AT 10:20 GMT by ORCHARD Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Molecular systems biology 2019 imex curation Diether M., Nikolaev Y., Allain FH., Sauer U. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. Transference of acetyl group from acetyl phosphate to Coenzyme A was monitored via FIA TOF‐MS. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Accepted 2019-DEC-05 AT 10:20 GMT AT 10:20 GMT by ORCHARD Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Systematic mapping of protein-metabolite interactions in central metabolism of Escherichia coli. Molecular systems biology 2019 imex curation Diether M., Nikolaev Y., Allain FH., Sauer U. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Diether M., Nikolaev Y., Allain FH., Sauer U. This assay monitored the cleavage of fructose-6-phosphate into dihydroxyacetone and D-glyceraldehyde-3-phosphate. Reactants concentrations were measured by FIA TOF‐MS. yaroslav.v.nikolaev@gmail.com,sauer@imsb.biol.ethz.ch Accepted 2019-DEC-05 AT 10:20 GMT AT 10:20 GMT by ORCHARD Molecular systems biology 2019 Only protein-protein interactions imex curation imex curation phenylpyruvate phenylpyruvate phenylpyruvates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dribulose 5phosphate D-ribulose 5-phosphate D-erythro-pent-2-ulose 5-(dihydrogen phosphate) D-Ribulose 5-phosphate 5-O-phosphono-D-ribulose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lcystathionine L-cystathionine (R)-S-(2-amino-2-carboxyethyl)-L-Homocysteine L-(+)-Cystathionine L-Cystathionine S-(beta-amino-beta-carboxyethyl)homocysteine (2S)-2-amino-4-{[(2R)-2-amino-2-carboxyethyl]sulfanyl}butanoic acid L-cystathionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pta_ecoli Phosphate acetyltransferase Phosphotransacetylase pta b2297 JW2294 protein protein ecoli Escherichia coli (strain K12) MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRTGGDAPDQTTTIVRANSSTTTAAEPLKMSYVEGLLSSNQKDVLMEEIVANYHANTKDAEVVLVEGLVPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLKERIELTRNSFGGAKNTNITGVIVNKLNAPVDEQGRTRPDLSEIFDDSSKAKVNNVDPAKLQESSPLPVLGAVPWSFDLIATRAIDMARHLNATIINEGDINTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVLVAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSFNLEVPVDDHERIEKVQEYVANYINADWIESLTATSERSRRLSPPAFRYQLTELARKAGKRIVLPEGDEPRTVKAAAICAERGIATCVLLGNPAEINRVAASQGVELGAGIEIVDPEVVRESYVGRLVELRKNKGMTETVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSAAAFGIEPRVAMLSYSTGTSGAGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAPNSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQSAQQQ DIP protein P0A9M8 original sequence version: 45 B45AF0C93494A04C itaconic acid itaconic acid 2-methylenesuccinic acid 2-propene-1,2-dicarboxylic acid Itaconic acid methylenebutanedioic acid Methylenesuccinic acid propylenedicarboxylic acid 2-methylidenebutanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pgk_ecoli Phosphoglycerate kinase pgk b2926 JW2893 protein protein ecoli Escherichia coli (strain K12) MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVAEGELVVLENVRFNKGEKKDDETLSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTCNIPVPSDVRVATEFSETAPATLKSVNDVKADEQILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEERAKK DIP protein P0A799 original sequence version: 50 FAD7D66D100514B2 ctp CTP 5'-CTP CTP Cytidine 5'-triphosphate Cytidine triphosphate CYTIDINE-5'-TRIPHOSPHATE H4ctp cytidine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) PCDQPRRSZKQHHS-XVFCMESISA-N PCDQPRRSZKQHHS-XVFCMESISA-N dfructose 1,6bisphosphate D-fructose 1,6-bisphosphate Diphosphofructose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) alkh_ecoli KHG/KDPG aldolase hga kdgA b1850 eda JW1839 protein protein ecoli Escherichia coli (strain K12) MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAKL CC8D51B50480D0B7 g6pi_ecoli Glucose-6-phosphate isomerase JW3985 pgi b4025 Phosphoglucose isomerase Phosphohexose isomerase protein protein ecoli Escherichia coli (strain K12) MKNINPTQTAAWQALQKHFDEMKDVTIADLFAKDGDRFSKFSATFDDQMLVDYSKNRITEETLAKLQDLAKECDLAGAIKSMFSGEKINRTENRAVLHVALRNRSNTPILVDGKDVMPEVNAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSARDWFLKAAGDEKHVAKHFAALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIVLSIGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLSDHHQKLLSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLDYVVPFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIFTFDQWGVELGKQLANRILPELKDDKEISSHDSSTNGLINRYKAWRG 74AEDB670A068A01 l-asparagine L-asparagine (2S)-2,4-diamino-4-oxobutanoic acid (2S)-2-amino-3-carbamoylpropanoic acid (S)-2-amino-3-carbamoylpropanoic acid (S)-Asparagine 2-Aminosuccinamic acid alpha-aminosuccinamic acid Asn ASPARAGINE Aspartamic acid L-2-aminosuccinamic acid L-Asparagin L-Asparagine L-aspartic acid beta-amide N L-asparagine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) idh_ecoli Isocitrate dehydrogenase [NADP] icd icdA icdE b1136 JW1122 Oxalosuccinate decarboxylase NADP(+)-specific ICDH IDP protein protein ecoli Escherichia coli (strain K12) MESKVVVPAQGKKITLQNGKLNVPENPIIPYIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEGAFKDWGYQLAREEFGGELIDGGPWLKVKNPNTGKEIVIKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMGWTEAADLIVKGMEGAINAKTVTYDFERLMDGAKLLKCSEFGDAIIENM DIP protein P08200 original sequence version: 108 9A02E707C3B4FDD9 fad FAD - Flavin adenine dinucleotide Adenosine 5'-(trihydrogen pyrophosphate), 5'-5'-ester with riboflavine adenosine 5'-[3-(riboflavin-5'-yl) dihydrogen diphosphate] FAD Flavin adenine dinucleotide FLAVIN-ADENINE DINUCLEOTIDE Riboflavin 5'-(trihydrogen diphosphate), 5'-5'-ester with adenosine Riboflavin 5'-adenosine diphosphate adenosine 5'-(3-{D-ribo-5-[7,8-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl} dihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) Flavin adenine dinucleotide Flavin adenine dinucleotide dglucose 6phosphate D-glucose 6-phosphate 6-O-phosphono-D-glucose D-glucose 6-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pfka_ecoli ATP-dependent 6-phosphofructokinase isozyme 1 6-phosphofructokinase isozyme I Phosphohexokinase 1 pfkA b3916 JW3887 protein protein ecoli Escherichia coli (strain K12) MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY This sequence has been withdrawn from Uniprot. D03D79F6A5536A41 D03D79F6A5536A41 gpma_ecoli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase gpmA gpm pgm pgmA b0755 JW0738 protein protein ecoli Escherichia coli (strain K12) MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK DIP protein P62707 original sequence version: 62 A6E0A49406F8482A pcka_ecoli Phosphoenolpyruvate carboxykinase (ATP) pckA pck b3403 JW3366 protein protein ecoli Escherichia coli (strain K12) MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTGIFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFVVDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEIYNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQYAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNLAIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL A744D90899F6A8A5 kpyk1_ecoli Pyruvate kinase I pykF b1676 JW1666 PK-1 protein protein ecoli Escherichia coli (strain K12) MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKLRITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL DIP protein P0AD61 original sequence version: 92 E29BF01B90327D8B g3p1_ecoli Glyceraldehyde-3-phosphate dehydrogenase A gapA NAD-dependent glyceraldehyde-3-phosphate dehydrogenase JW1768 b1779 protein protein ecoli Escherichia coli (strain K12) MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSNKVLDLIAHISK DIP protein P0A9B2 original sequence version: 55 B3A460AA6D59E46D alf_ecoli Fructose-bisphosphate aldolase class 2 fbaA fba fda Fructose-1,6-bisphosphate aldolase Fructose-bisphosphate aldolase class II b2925 JW2892 protein protein ecoli Escherichia coli (strain K12) MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL DIP protein P0AB71 original sequence version: 85 7A076D9EA62FBEC4 acea_ecoli Isocitrate lyase aceA icl b4015 JW3975 Isocitrase Isocitratase protein protein ecoli Escherichia coli (strain K12) MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTSSVTALTGSTEESQF F66449CCD1E168E9 3',5'-cyclic amp 3',5'-cyclic AMP 3',5'-Cyclic AMP adenosine 3',5'-cyclic monophosphate Adenosine 3',5'-cyclic phosphate Adenosine 3',5'-phosphate ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE cAMP Cyclic adenylic acid Cyclic AMP adenosine 3',5'-(hydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rpia_ecoli Ribose-5-phosphate isomerase A rpiA b2914 JW5475 ygfC Phosphoriboisomerase A protein protein ecoli Escherichia coli (strain K12) MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADASKQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPIAMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK DIP protein P0A7Z0 original sequence version: 83 B53C49CC3DB188BC edd_ecoli Phosphogluconate dehydratase 6-phosphogluconate dehydratase edd Entner-Doudoroff dehydrase JW1840 b1851 protein protein ecoli Escherichia coli (strain K12) MNPQLLRVTNRIIERSRETRSAYLARIEQAKTSTVHRSQLACGNLAHGFAACQPEDKASLKSMLRNNIAIITSYNDMLSAHQPYEHYPEIIRKALHEANAVGQVAGGVPAMCDGVTQGQDGMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIVPGLTMAALSFGHLPAVFVPSGPMASGLPNKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCTFYGTANTNQMVVEFMGMQLPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKMIDEKVVVNGIVALLATGGSTNHTMHLVAMARAAGIQINWDDFSDLSDVVPLMARLYPNGPADINHFQAAGGVPVLVRELLKAGLLHEDVNTVAGFGLSRYTLEPWLNNGELDWREGAEKSLDSNVIASFEQPFSHHGGTKVLSGNLGRAVMKTSAVPVENQVIEAPAVVFESQHDVMPAFEAGLLDRDCVVVVRHQGPKANGMPELHKLMPPLGVLLDRCFKIALVTDGRLSGASGKVPSAIHVTPEAYDGGLLAKVRDGDIIRVNGQTGELTLLVDEAELAAREPHIPDLSASRVGTGRELFSALREKLSGAEQGATCITF D046405193BFC185 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 amp Adenosine monophosphate 5'-Adenosine monophosphate 5'-Adenylic acid 5'-AMP 5'-O-phosphonoadenosine adenosine 5'-(dihydrogen phosphate) Adenosine 5'-monophosphate Adenosine 5'-phosphate ADENOSINE MONOPHOSPHATE adenosine phosphate Adenosine-5'-monophosphoric acid adenosine-5'P adenosini phosphas Adenylate Adenylic acid Ado5'P AMP fosfato de adenosina pA PAdo phosphate d'adenosine 5'-adenylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) eno_ecoli Enolase eno b2779 JW2750 2-phosphoglycerate dehydratase 2-phospho-D-glycerate hydro-lyase protein protein ecoli Escherichia coli (strain K12) MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA DIP protein P0A6P9 original sequence version: 56 0569036E87471B91 dttp dTTP 2'-deoxythymidine triphosphate 5'-TTP deoxy-TTP Deoxythymidine 5'-triphosphate Deoxythymidine triphosphate dThd5'PPP dTTP pppdT thymidine 5'-triphosphate THYMIDINE-5'-TRIPHOSPHATE TTP thymidine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rpe_ecoli Ribulose-phosphate 3-epimerase rpe dod b3386 yhfD Pentose-5-phosphate 3-epimerase R5P3E JW3349 protein protein ecoli Escherichia coli (strain K12) MKQYLIAPSILSADFARLGEDTAKALAAGADVVHFDVMDNHYVPNLTIGPMVLKSLRNYGITAPIDVHLMVKPVDRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPQTLDKLREVRRRIDESGFDIRLEVDGGVKVNNIGEIAAAGADMFVAGSAIFDQPDYKKVIDEMRSELAKVSHE DIP protein P0AG07 original sequence version: 35 DD678085698466FA malonic acid malonic acid H2malo HOOC-CH2-COOH Malonic acid MALONIC ACID Propanedioic acid propanedioic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nad NAD nicotinamide-adenine dinucleotide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphoenolpyruvate phosphoenolpyruvate 2-(phosphonooxy)-2-propenoate 2-(phosphonooxy)acrylate 2-hydroxy-2-propenoate (dihydrogen phosphate) (ester) 2-hydroxy-2-propenoate phosphate (ester) O-phosphono-enol-pyruvate PEP Phosphoenolpyruvate PHOSPHOENOLPYRUVATE phosphoenolpyruvate(1-) 2-(phosphonooxy)prop-2-enoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 5ophosphonoalphadribofuranosyl diphosphate 5-O-phosphono-alpha-D-ribofuranosyl diphosphate 5-Phospho-alpha-D-ribose 1-diphosphate 5-Phosphoribosyl 1-pyrophosphate 5-Phosphoribosyl diphosphate alpha-D-ribofuranose 5-(dihydrogen phosphate) 1-(trihydrogen diphosphate) ALPHA-PHOSPHORIBOSYLPYROPHOSPHORIC ACID phosphoribosyl pyrophosphate phosphoribosylpyrophosphate PRib-PP PRPP 5-O-phosphono-alpha-D-ribofuranose 1-(trihydrogen diphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lleucine L-leucine (2S)-2-amino-4-methylpentanoic acid (2S)-alpha-2-Amino-4-methylvaleric acid (2S)-alpha-Leucine (S)-(+)-leucine (S)-leucine 2-Amino-4-methylvaleric acid L L-Leucin L-Leucine L-Leuzin Leu LEUCINE L-leucine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) acsa_ecoli Acetyl-coenzyme A synthetase acs b4069 JW4030 yfaC Acetate--CoA ligase Acyl-activating enzyme protein protein ecoli Escherichia coli (strain K12) MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS F464062B6E82C099 ltryptophan L-tryptophan (2S)-2-amino-3-(1H-indol-3-yl)propanoic acid (S)-alpha-amino-1H-indole-3-propanoic acid (S)-alpha-Amino-beta-(3-indolyl)-propionic acid (S)-tryptophan L-(-)-tryptophan L-beta-3-indolylalanine L-Tryptophan L-tryptophan Trp Tryptophan TRYPTOPHAN tryptophan W L-tryptophan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spermidine spermidine 1,5,10-triazadecane 4-azaoctamethylenediamine 4-azaoctane-1,8-diamine N-(3-Aminopropyl)-1,4-butane-diamine Spermidin SPERMIDINE Spermidine N-(3-aminopropyl)butane-1,4-diamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ATHGHQPFGPMSJY-UHFFFAOYSA-N ATHGHQPFGPMSJY-UHFFFAOYSA-N citric acid citric acid 2-Hydroxy-1,2,3-propanetricarboxylic acid 2-Hydroxytricarballylic acid 3-Carboxy-3-hydroxypentane-1,5-dioic acid Citric acid CITRIC ACID Citronensaeure E330 H3cit 2-hydroxypropane-1,2,3-tricarboxylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) d-glucopyranose 6-phosphate D-glucopyranose 6-phosphate 6-O-phosphono-D-glucopyranose D-Glucose 6-phosphate Glc6P Robison ester D-glucopyranose 6-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) imp IMP 2'-inosine-5'-monophosphate 5'-IMP 5'-Inosinate 5'-Inosine monophosphate 5'-Inosinic acid hypoxanthosine 5'-monophosphate IMP Inosine 5'-monophosphate Inosine 5'-phosphate Inosine monophosphate inosinic acid Inosinic acid ribosylhypoxanthine monophosphate 5'-inosinic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) GRSZFWQUAKGDAV-KQYNXXCUSA-N GRSZFWQUAKGDAV-KQYNXXCUSA-N lhistidine L-histidine (S)-4-(2-Amino-2-carboxyethyl)imidazole (S)-alpha-amino-1H-Imidazole-4-propanoic acid (S)-alpha-Amino-1H-imidazole-4-propionic acid H His HISTIDINE L-(-)-histidine L-Histidin L-Histidine (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid L-histidine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) coenzyme a coenzyme A [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]methyl (3R)-3-hydroxy-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)-2,2-dimethyl-4-oxobutyl dihydrogen diphosphate 3'-phosphoadenosine-(5')diphospho(4')pantatheine CoA CoA-SH CoASH Coenzym A Coenzyme A COENZYME A HSCoA Koenzym A 3'-phosphoadenosine 5'-{3-[(3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nadp NADP nicotinamide-adenine dinucleotide phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mao1_ecoli NAD-dependent malic enzyme sfcA JW5238 b1479 maeA protein protein ecoli Escherichia coli (strain K12) MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERAWIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYRRSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYTACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPDVLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRENLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPTSRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGASRITDEMLMSASETLAQYSPLVLNGEGMVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTSAEALQQAIDDNFWQAEYRDYRRTSI FFD61212F709EE3A 3phosphodglyceric acid 3-phospho-D-glyceric acid (2R)-2-hydroxy-3-(phosphonooxy)propanoic acid 3-phospho-D-glycerate 3-Phospho-D-glycerate 3-Phosphoglycerate D-glycerate 3-phosphate D-Glycerate 3-phosphate 3-Phospho-(R)-glycerate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tpis_ecoli Triosephosphate isomerase tpiA tpi b3919 JW3890 Triose-phosphate isomerase protein protein ecoli Escherichia coli (strain K12) MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQA E398251020012D94 E398251020012D94 acetyl dihydrogen phosphate acetyl dihydrogen phosphate acetic acid, monoanhydride with phosphoric acid acetyl dihydrogen phosphate Acetyl phosphate ACETYLPHOSPHATE acetylphosphoric acid monoacetyl phosphate (acetyloxy)phosphonic acid acetic phosphoric monoanhydride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nadp+ 2'-O-phosphonoadenosine 5'-{3-[1-(3-carbamoylpyridinio)-1,4-anhydro-D-ribitol-5-yl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) malate malate malate anion malates malic acid anion small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6-phospho-d-gluconic acid 6-phospho-D-gluconic acid 6-Phospho-D-gluconate 6-O-phosphono-D-gluconic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6pgd_ecoli 6-phosphogluconate dehydrogenase, decarboxylating gnd b2029 JW2011 protein protein ecoli Escherichia coli (strain K12) MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD DIP protein P00350 original sequence version: 90 62A32C84DC596D86 mao2_ecoli NADP-dependent malic enzyme maeB b2463 ypfF JW2447 protein protein ecoli Escherichia coli (strain K12) MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFIEVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAYAVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKLTEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIGAIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYVNDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAPELMIDGEMHGDAALVEAIRNDRMPDSSLKGSANILVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL DIP protein P76558 original sequence version: null 9A8B67D9635E25BA g6pd_ecoli Glucose-6-phosphate 1-dehydrogenase zwf b1852 JW1841 protein protein ecoli Escherichia coli (strain K12) MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTKVVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQKNRITINYFAMPPSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLGKETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDKAGQMRDMIQNHLLQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPGYLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLFKESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMITRDGRSWNEFE 263F07D298EAFCD3 mdh_ecoli Malate dehydrogenase mdh b3236 JW3205 protein protein ecoli Escherichia coli (strain K12) MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK DIP protein P61889 original sequence version: 65 17741A3B5AD068BA fuma_ecoli Fumarate hydratase class I, aerobic fumA Fumarase A Oxaloacetate keto--enol-isomerase Oxaloacetate tautomerase JW1604 b1612 protein protein ecoli Escherichia coli (strain K12) MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASFMLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQRVWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKFLCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAETNLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVRVDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQLTQCTRCVK 6082744088C64603 6082744088C64603 3phosphodglyceric acid-acea-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) AceA Isocitrate lyase 26 unspecified role unspecified role neutral component neutral component purified purified C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1959 Dataset EV2 3phosphodglyceric acid-fbaa-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.5214 Dataset EV2 3phosphodglyceric acid-gapa-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GapA Glyceraldehyde 3-phosphate dehydrogenase 24 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1897 Dataset EV2 3phosphodglyceric acid-gnd-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Gnd 6-Phosphogluconate dehydrogenase 56 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1913 Dataset EV2 3phosphodglyceric acid-maea-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1817 Dataset EV2 3phosphodglyceric acid-pcka-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PckA PEP Carboxykinase 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4426 Dataset EV2 3phosphodglyceric acid-pgk-1 1 D-(-)-3-Phosphoglycerate 3PG 50 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3662 Dataset EV2 6phosphodgluconic acid-eda-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 14 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4836 Dataset EV2 6phosphodgluconic acid-fbaa-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2656 Dataset EV2 6phosphodgluconic acid-gnd-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Gnd 6-Phosphogluconate dehydrogenase 56 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3524 Dataset EV2 6phosphodgluconic acid-maea-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2719 Dataset EV2 6phosphodgluconic acid-maeb-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1875 Dataset EV2 6phosphodgluconic acid-pgi-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgi Phosphoglucose isomerase 15 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.5173 Dataset EV2 6phosphodgluconic acid-pgk-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2482 Dataset EV2 6phosphodgluconic acid-zwf-1 1 6-Phosphogluconate 6PG 55 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Zwf Glucose 6-phosphate-1-dehydrogenase 58 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1857 Dataset EV2 acs-adenosine 5'monophosphate-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Acs Acetyl-CoA-synthetase 40 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2367 Dataset EV2 adenosine 5'monophosphate-fbaa-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3258 Dataset EV2 adenosine 5'monophosphate-gapa-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GapA Glyceraldehyde 3-phosphate dehydrogenase 24 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.7528 Dataset EV2 adenosine 5'monophosphate-maeb-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2559 Dataset EV2 adenosine 5'monophosphate-pcka-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PckA PEP Carboxykinase 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2752 Dataset EV2 adenosine 5'monophosphate-pfka-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2317 Dataset EV2 adenosine 5'monophosphate-pgk-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3166 Dataset EV2 adenosine 5'monophosphate-rpe-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Rpe Ribulose-5-phosphate 3-epimerase 34 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3783 Dataset EV2 adenosine 5'monophosphate-rpia-1 1 Adenosine 5′-monophosphate AMP 31 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) RpiA Ribose-5-phosphate isomerase 28 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3729 Dataset EV2 edd-lasparagine-1 1 L-Asparagine ASN 16 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Edd Phosphogluconate dehydratase 29 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2815 Dataset EV2 gpma-lasparagine-1 1 L-Asparagine ASN 16 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  21 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1982 Dataset EV2 lasparagine-maeb-1 1 L-Asparagine ASN 16 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1888 Dataset EV2 acs-atp-1 1 Adenosine 5′-trihosphate ATP 8 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Acs Acetyl-CoA-synthetase 40 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2435 Dataset EV2 atp-fbaa-1 1 Adenosine 5′-trihosphate ATP 8 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3265 Dataset EV2 atp-pcka-1 1 Adenosine 5′-trihosphate ATP 8 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PEP Carboxykinase PckA 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3768 Dataset EV2 atp-pgk-1 1 Adenosine 5′-trihosphate ATP 8 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2997 Dataset EV2 atp-zwf-1 1 Adenosine 5′-trihosphate ATP 8 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Zwf Glucose 6-phosphate-1-dehydrogenase 58 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2212 Dataset EV2 citric acid-fbaa-1 1 Citrate CIT 43 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3812 Dataset EV2 citric acid-icd-1 1 Citrate CIT 43 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Icd Isocitrate dehydrogenase 17 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2224 Dataset EV2 citric acid-maeb-1 1 Citrate CIT 43 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2479 Dataset EV2 citric acid-pcka-1 1 Citrate CIT 43 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PckA PEP Carboxykinase 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1833 Dataset EV2 ctp-edd-1 1 Cytidine 5′-triphosphate CTP 12 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Edd Phosphogluconate dehydratase 29 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.194 Dataset EV2 ctp-pfka-1 1 Cytidine 5′-triphosphate CTP 12 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3814 Dataset EV2 edd-lcystathionine-1 1 L-Cystathionine CYSTAT 7 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Edd Phosphogluconate dehydratase 29 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.222 Dataset EV2 acs-fad-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Acs Acetyl-CoA-synthetase 40 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2928 Dataset EV2 fad-gapa-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GapA Glyceraldehyde 3-phosphate dehydrogenase 24 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4969 Dataset EV2 fad-maea-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3875 Dataset EV2 fad-mdh-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Mdh Malate dehydrogenase 59 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2228 Dataset EV2 fad-pfka-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3287 Dataset EV2 fad-pta-1 1 Flavin adenine dinucleotide FAD 18 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pta Phosphate acetyltransferase  9 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2773 Dataset EV2 dfructose 1,6bisphosphate-pfka-1 1 D-Fructose 1,6-bisphosphate FBP 13 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1945 Dataset EV2 dglucose 6phosphate-pgi-1 1 D-Glucose-6-phosphate G6P 19 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgi Phosphoglucose isomerase 15 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4522 Dataset EV2 dglucose 6phosphate-rpe-1 1 D-Glucose-6-phosphate G6P 19 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Rpe Ribulose-5-phosphate 3-epimerase 34 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3682 Dataset EV2 acs-gtp-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Acs Acetyl-CoA-synthetase 40 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.235 Dataset EV2 edd-gtp-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Edd Phosphogluconate dehydratase 29 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.269 Dataset EV2 fbaa-gtp-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.288 Dataset EV2 gnd-gtp-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Gnd 6-Phosphogluconate dehydrogenase 56 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2674 Dataset EV2 gpma-gtp-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  21 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2117 Dataset EV2 gtp-maeb-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.292 Dataset EV2 gtp-pfka-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3499 Dataset EV2 gtp-pgi-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgi Phosphoglucose isomerase 15 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3184 Dataset EV2 gtp-pgk-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3442 Dataset EV2 gtp-pta-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pta Phosphate acetyltransferase  9 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2482 Dataset EV2 gtp-pykf-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PykF Pyruvate kinase  23 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2596 Dataset EV2 gtp-tpia-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) TpiA Triosephosphate isomerase 51 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2483 Dataset EV2 gtp-zwf-1 1 Guanosine 5′-triphosphate GTP 30 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Zwf Glucose 6-phosphate-1-dehydrogenase 58 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2289 Dataset EV2 lhistidine-maea-1 1 L-Histidine HIS 46 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1822 Dataset EV2 lhistidine-maeb-1 1 L-Histidine HIS 46 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2356 Dataset EV2 lhistidine-pgk-1 1 L-Histidine HIS 46 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2714 Dataset EV2 imp-zwf-1 1 Inosine 5′-monophosphate IMP 45 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Zwf Glucose 6-phosphate-1-dehydrogenase 58 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2748 Dataset EV2 eda-itaconic acid-1 1 Itaconate ITA 10 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 14 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2559 Dataset EV2 lleucine-rpe-1 1 L-Leucine LEU 39 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Rpe Ribulose-5-phosphate 3-epimerase 34 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1824 Dataset EV2 maeb-malate-1 1 MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) L-Malate MAL 54 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction author score author-based confidence author score RF = 0.2377 Dataset EV2 malate-pgk-1 1 L-Malate MAL 54 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgk Phosphoglycerate kinase 11 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2965 Dataset EV2 acea-malonic acid-1 1 Malonate MALON 35 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) AceA Isocitrate lyase 26 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2864 Dataset EV2 fbaa-malonic acid-1 1 Malonate MALON 35 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.5633 Dataset EV2 maea-malonic acid-1 1 Malonate MALON 35 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2632 Dataset EV2 maeb-malonic acid-1 1 Malonate MALON 35 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3192 Dataset EV2 gapa-nad-1 1 Nicotinamide adenine dinucleotide  NAD 36 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GapA Glyceraldehyde 3-phosphate dehydrogenase 24 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.5493 Dataset EV2 maea-nad-1 1 Nicotinamide adenine dinucleotide  NAD 36 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4975 Dataset EV2 nad-pfka-1 1 Nicotinamide adenine dinucleotide  NAD 36 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PfkA 6-Phosphofructokinase 20 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3465 Dataset EV2 fbaa-nadp-1 1 nicotinamide adenine dinucleotide phosphate  NADP 48 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2288 Dataset EV2 gnd-nadp-1 1 nicotinamide adenine dinucleotide phosphate  NADP 48 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Gnd 6-Phosphogluconate dehydrogenase 56 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3577 Dataset EV2 icd-nadp-1 1 nicotinamide adenine dinucleotide phosphate  NADP 48 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Icd Isocitrate dehydrogenase 17 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3145 Dataset EV2 eda-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Eda 2-Keto-3-deoxygluconate 6-phosphate aldolase 14 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1923 Dataset EV2 eno-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Eno Enolase 32 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2497 Dataset EV2 fbaa-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1974 Dataset EV2 gpma-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GpmA 2,3-Bisphosphoglycerate-dependent phosphoglycerate mutase  21 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.6324 Dataset EV2 icd-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Icd Isocitrate dehydrogenase 17 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1942 Dataset EV2 pcka-phosphoenolpyruvate-1 1 Phosphoenolpyruvate PEP 37 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PckA PEP Carboxykinase 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4234 Dataset EV2 5ophosphonoalphadribofuranosyl diphosphate-fbaa-1 1 5-Phospho-D-ribose 1-diphosphate PRPP 38 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2275 Dataset EV2 fbaa-phenylpyruvate-1 1 Phenylpyruvate PhePYR 5 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.1828 Dataset EV2 maeb-phenylpyruvate-1 1 Phenylpyruvate PhePYR 5 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2987 Dataset EV2 phenylpyruvate-pta-1 1 Phenylpyruvate PhePYR 5 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pta Phosphate acetyltransferase  9 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2416 Dataset EV2 dribulose 5phosphate-pgi-1 1 D-Ribulose-5-phosphate R5P 6 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pgi Phosphoglucose isomerase 15 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2564 Dataset EV2 fuma-spermidine-1 1 Spermidine SPER 42 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FumA Fumarase 60 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2789 Dataset EV2 ltryptophan-maeb-1 1 L-Tryptophan TRP 41 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2985 Dataset EV2 ltryptophan-pta-1 1 L-Tryptophan TRP 41 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Pta Phosphate acetyltransferase  9 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2164 Dataset EV2 dttp-pcka-1 1 Thymidine 5′-triphosphate TTP 33 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) PckA PEP Carboxykinase 22 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2596 Dataset EV2 3',5'cyclic amp-acs-1 1 Adenosine 3′,5′-cyclic monophosphate cAMP 27 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Acs Acetyl-CoA-synthetase 40 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.3737 Dataset EV2 3',5'cyclic amp-gapa-1 1 Adenosine 3′,5′-cyclic monophosphate cAMP 27 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) GapA Glyceraldehyde 3-phosphate dehydrogenase 24 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.4736 Dataset EV2 3',5'cyclic amp-maea-1 1 Adenosine 3′,5′-cyclic monophosphate cAMP 27 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeA Malic enzyme 49 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2858 Dataset EV2 3',5'cyclic amp-maeb-1 1 Adenosine 3′,5′-cyclic monophosphate cAMP 27 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) MaeB Malic enzyme 57 unspecified role unspecified role neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction author score author-based confidence author score RF = 0.2883 Dataset EV2 d_glucopyranose 6_phosphate-nadp+-1 2 53 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 44 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Zwf Glucose 6-phosphate-1-dehydrogenase 58 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 5A, Dataset EV3 ATP (CHEBI:15422) GTP (CHEBI:15996) pta-1 3 47 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 52 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Phosphate acetyltransferase Pta 9 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 5B, Dataset EV3 The assay showed a small, but insignificant concentration‐dependent inhibitory effect of phenylpyruvate (CHEBI:26008) and no inhibitory effect of l‐tryptophan (CHEBI:16828) on phosphate acetyltransferase activity. fbaa-4 4 13 enzyme target enzyme target substrate substrate neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) FbaA Fructose bisphosphate aldolase 25 enzyme enzyme neutral component neutral component purified purified N-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Figure 5C, Dataset EV3 3PG (CHEBI:17794) ATP (CHEBI:15422) PEP (CHEBI:18021)