IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down sequence tag sequence tag identification sequence tag McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro deamination deamination assay aminase assay deamination weight by staining molecular weight estimation by staining weight by staining McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy The single-stranded DNA substrate contained a single target cytosine; deamination, uracil excision, and backbone cleavage resulted in a single faster-migrating product on SDS–polyacrylamide gel electrophoresis. dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The DNA deaminase APOBEC3B interacts with the cell-cycle protein CDK4 and disrupts CDK4-mediated nuclear import of Cyclin D1. The Journal of biological chemistry 2019 imex curation McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot McCann JL., Klein MM., Leland EM., Law EK., Brown WL., Salamango DJ., Harris RS. Figure 4, 5C/D uses chimeric constructs; interactions involving these have not been annotated as they are of dubious biological relevance. if you cannot get access to this publication I can send you a copy dsalaman@umn.edu,rsh@umn.edu Accepted 2020-JAN-08 AT 03:47 GMT AT 03:47 GMT by KALPANAP The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A oligo_substrate ss dna single stranded deoxyribonucleic acid ss DNA ss dna synthetic construct synthetic construct ATTATTATTATTCAAATGGATTTATTTATTTATTTATTTATTT blat of this sequence does not remotely match anything in human genome cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE DIP protein P11802 original sequence version: 177 DIP protein P11802 original sequence version: 135 DIP protein P11802 original sequence version: 136 DIP protein P11802 original sequence version: 200 DIP protein P11802 original sequence version: 86 0916A0C07403A33A abc3b_human DNA dC->dU-editing enzyme APOBEC-3B APOBEC3B Phorbolin-1-related protein Phorbolin-2/3 protein protein human Homo sapiens Human MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQGCPFQPWDGLEEHSQALSGRLRAILQNQGN DA6EDD23E8856240 abc3a_human DNA dC->dU-editing enzyme APOBEC-3A APOBEC3A Phorbolin-1 protein protein human Homo sapiens Human MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN DIP protein P31941 original sequence version: 134 DIP protein P31941-1 original sequence version: 135 42E99E0D7DF7AA14 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 apobec3b-cdk4-2 3 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1 apobec3b-cdk4-1 8 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2A cdk4-apobec3b-1 7 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B-1 cdk4-apobec3b-2 7 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B-4 cdk4-apobec3b-3 7 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range NTF sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B-2, 2D NTD taken from Fig 4. cdk4-apobec3b-4 7 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B-3, 5B apobec3b-cdk4-3 5 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9UH17:p.Glu255Ala mutation mutation certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 19:01:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu255Ala' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2C apobec3b-cdk4-4 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction 2E apobec3b-cdk4-5 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction 2E-2 A3B and CDK4 showed PLA foci in the nuclear compartment; CDK4 and Cyclin D1 PLA foci were cell-wide. ccnd1-cdk4-24 6 9 enzyme regulator enzyme regulator neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 14 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 enzyme enzyme neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation 3A positive control apobec3a-oligo_substrate-1 4 13 enzyme enzyme neutral component neutral component purified purified 10 enzyme target enzyme target substrate substrate neutral component neutral component C-terminus fluorescein fluorescein label fluorescein c-term range C-terminal range c-term range c-term range C-terminal range c-term range synthetic construct synthetic construct deamination deamination reaction deamination 3C apart from "purified" + "recombinant" there appears to be no info on the A3A protein given. positive control apobec3b-ccnd1-1 1 12 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 6 A-C in the presence of A3B-eGFP, A3B and CDK4 were found to co- localize in the nuclear compartment, whereas Cyclin D1 became more cell-wide. apobec3b-ccnd1-2 1 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 6 A-Ci