DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1. Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1. Science (New York, N.Y.) 2019 imex curation Gu J., Zhang L., Zong S., Guo R., Liu T., Yi J., Wang P., Zhuo W., Yang M. maojunyang@tsinghua.edu.cn 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Gu J., Zhang L., Zong S., Guo R., Liu T., Yi J., Wang P., Zhuo W., Yang M. maojunyang@tsinghua.edu.cn Accepted 2019-JUL-25 AT 08:28 BST AT 08:28 BST by MGT Science (New York, N.Y.) 2019 imex curation uh... this is specialty of cryo-EM :o( the papers often report one 'overall' structure of the entire complex as one PDB and then a few PDBs with fragments of the very same complex modeled/refined separately (it's called 'focused refinement'; it is commonly used in cases when a complex is flexible and only smaller fragments of the images can be aligned to get higher resolution model; these are not separate complexes of different stiochiometry but 'sharpened' views of fragments of the same complex). I'm just pondering how to enter another paper with about 30 or so PDBs corresponding to different conformations of different fragments of the same complex - in principle all the pdbs should be entered as crossreferences... q4vt52_pig ATP synthase lipid-binding protein ATPase protein 9 ATPase subunit c protein protein pig Sus scrofa (Pig) Pig MQTTGALLISPALLRSCTRGLIRPVSASFLSRPEIPSEQLPCSSVPLQVARREFQASVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSMIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM 6D0835FDE74EE4FE a0a287a9i8_pig ATP synthase subunit gamma ATP5F1C protein protein pig Sus scrofa (Pig) Pig MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERDLKPARVYGIGSLALYEKADIKVPEDKKKHLIIGVSSDRGLCGAIHSSVAKQIKSEVANLTAAGKEVKIVGVGDKIRGILHRTHSDQFLVTFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTVASAESMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALE A1C17BE3B1E760EB a5gfx4_pig ATP5E CH242-247L10.5-002 protein protein pig Sus scrofa (Pig) Pig MVAYWRQAGLSYIRYSQICAKAVRDALKAEFKANAEKTSGSNVKIVKVKKE 36E8FDA7C91907A5 atif1_pig ATPase inhibitor, mitochondrial ATP synthase F1 subunit epsilon Inhibitor of F(1)F(o)-ATPase ATP5IF1 ATPI ATPIF1 protein protein pig Sus scrofa (Pig) Pig MAATALAVRSRIGAWSVWAMQSRGFSSDTPEGVRSGAGAVRDAGGAFGKKEQADEERYFRARAREQLAALKKHHENEISHHVKEIERLQKEIERHKQSIKKLKNDDDD 4913E7FA3429C87A atpa_pig ATP synthase subunit alpha, mitochondrial ATP synthase F1 subunit alpha ATP synthase subunit alpha heart isoform, mitochondrial ATP synthase subunit alpha liver isoform, mitochondrial ATP5F1A ATP5A1 ATP5A2 protein protein pig Sus scrofa (Pig) Pig MLSVRVAAAVARALPRRAGLVSKNALGSSFVAARNLHASNTRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYAPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRADGKISEETDAKLKEIVTNFLAGFEA A66233929D65FF19 a0a287b4i0_pig ATP synthase subunit d, mitochondrial ATP5PD protein protein pig Sus scrofa (Pig) Pig MAGRKLALKAIDWVAFGEIIPRNQKAIANSLKSWNETLSTRLAALPEKPPAIDWAYYKATVAKAGLVDDFEKKVKRCAEFLSLSKARIEAYEKELEKMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIESL EC0438C87C3A6C94 atp6_pig ATP synthase subunit a MT-ATP6 ATP6 ATPASE6 MTATP6 F-ATPase protein 6 protein protein pig Sus scrofa (Pig) Pig MNENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQLTSKQMMAIHNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMNLGMAIPLWSATVFTGFRYKTKTSLAHFLPQGTPALLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLALLNINTMTAFITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT BE197F3B086FEEA2 a0a286zyl7_pig ATP synthase F1 subunit delta ATP5F1D protein protein pig Sus scrofa (Pig) Pig MLPATLLRRSGLGRVVRQARAYAEAAAAPASAAGPGQMSFTFASPTQVFFNGANVRQVDVPTQTGAFGILASHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDPGVAKANLEKAQSELLGAADEASRAEIQIRIEANEALVKALE 7CEE598FCB060EFC atp5j_pig ATP synthase-coupling factor 6, mitochondrial ATP synthase peripheral stalk subunit F6 ATP5PF ATP5J protein protein pig Sus scrofa (Pig) Pig NKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFEAVEKPQS 16F73EE42F87B874 atp8_pig ATP synthase protein 8 A6L F-ATPase subunit 8 MT-ATP8 ATP8 ATPASE8 MTATP8 protein protein pig Sus scrofa (Pig) Pig MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR 2890AA68B5CDD48E atpk_pig ATP synthase subunit f, mitochondrial ATP synthase membrane subunit f ATP5MF ATP5J2 protein protein pig Sus scrofa (Pig) Pig MASVVPLKDRRLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSVAGLSMVLAAYVVFNYCRSYKELKHERLRKYH 6B8A45E4B33C1A7B atpo_pig ATP synthase subunit O, mitochondrial ATP5PO ATP5O ATP synthase peripheral stalk subunit OSCP Oligomycin sensitivity conferral protein protein protein pig Sus scrofa (Pig) Pig MASQAVSGLSRQVRCFSTSVVRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASIMNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLSSTPGVISAFSTMMSVHRGEVPCSVTTASPLDEATLTELKTVLKSFLSKGQILKLEVKVDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMREIF F55A40E8850431EF f1rfd4_pig ATP5MK ATP5MD protein protein pig Sus scrofa (Pig) Pig MAGPETDAQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRSKKTPAVKAT 5BF1978FFC6A6BE3 a0a286zym6_pig ATP synthase subunit b ATP5PB protein protein pig Sus scrofa (Pig) Pig MLSRVVLSAAAAAAPSLKNAALLGPGVLQATRIFHTGQPSLAPVPPLPEHGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYVITAETFSAISTIGVLVYIVKKYGASIGAFADKLNEQKIAQLEEVKQASIKQIQDAIDLEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYKEIKNRLDYHISVQNMMRQKEQEHMIRWVEKHVVQSISAQQEKETIAKCIADLKLLAKKAQAQPVL 37B884100D8693F3 k7glt8_pig ATP synthase subunit beta ATP5F1B protein protein pig Sus scrofa (Pig) Pig MLRVISSKMIQRTCLLQSRPRPQLRGVGGQTAAALSLYPGSAMLGFVGRVASASASGALRGLSPSAPLPQAQLLLRAAPAALQPARDYATQPSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHS 7928D486D6C23DA7 atp5e-atp5f1a-1 1 14 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 12 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 7 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 10 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 15 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 8 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 13 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 2 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 4 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 9 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 3 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 16 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 6 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] 11 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component native native pig-heart Pig Heart heart Heart [Cardiac; Cardiac tissue] physical association physical association Fig 1, Fig 2, Tab S1