IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction map of Arabidopsis Mediator complex expounding its topology. Interaction map of Arabidopsis Mediator complex expounding its topology. Nucleic acids research 2019 imex curation Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 This yeast two-hybrid experiment was performed under stringent conditions (SD-Trp/-Leu/-Ade/-His medium). Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Accepted 2019-MAR-15 AT 16:24 GMT AT 16:24 GMT by MGT Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation Fig S5:omitted Med4 asBait-Med31 as Prey. could it be added to Expt-2? could be added to EBI-21254668. Pablo: added to EBI-21254668 Figure S6A EBI-21254461: I would have added 1-78 as Required to Bind. Pablo: Added. Figure S8A/B:You have shown in EBI-21254509 the two fragments interacting - this is not shown experimentally as one construct is always Full length- should be 2 interactions, one of which is Supp fig 8A which has been omitted. (Bait= med14 Prey Med 10 and one construct was Suff. to bind 1-197 for S8A. (sorry - i cannot see the original files, as on laptop, so I hope what I have written makes sense.) Pablo: Duplicated, with figure legends corrected. Please can you remove the "on-hold"? I cannot remember what is meant to be done with that annotation and when?? Pablo: I cannot! It was there pre-publication but I do not seem to be able to take it away. I'll check with the developers and see if we can get rid of it if it is a problem for the release. Interaction map of Arabidopsis Mediator complex expounding its topology. Interaction map of Arabidopsis Mediator complex expounding its topology. Nucleic acids research 2019 imex curation Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 This yeast two-hybrid experiment was performed under less stringent conditions (SD-Trp/-Leu/-Ade (TDO) medium, instead of the more stringent SD-Trp/-Leu/-Ade/-His medium). Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Accepted 2019-MAR-15 AT 16:24 GMT AT 16:24 GMT by MGT Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation Fig S5:omitted Med4 asBait-Med31 as Prey. could it be added to Expt-2? could be added to EBI-21254668. Pablo: added to EBI-21254668 Figure S6A EBI-21254461: I would have added 1-78 as Required to Bind. Pablo: Added. Figure S8A/B:You have shown in EBI-21254509 the two fragments interacting - this is not shown experimentally as one construct is always Full length- should be 2 interactions, one of which is Supp fig 8A which has been omitted. (Bait= med14 Prey Med 10 and one construct was Suff. to bind 1-197 for S8A. (sorry - i cannot see the original files, as on laptop, so I hope what I have written makes sense.) Pablo: Duplicated, with figure legends corrected. Please can you remove the "on-hold"? I cannot remember what is meant to be done with that annotation and when?? Pablo: I cannot! It was there pre-publication but I do not seem to be able to take it away. I'll check with the developers and see if we can get rid of it if it is a problem for the release. Interaction map of Arabidopsis Mediator complex expounding its topology. Interaction map of Arabidopsis Mediator complex expounding its topology. Nucleic acids research 2019 imex curation Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Maji S., Dahiya P., Waseem M., Dwivedi N., Bhat DS., Dar TH., Thakur JK. 2019-01-03: Submitted by JK Thakur, National Institute of Plant Genome Research, New Delhi, India Files for this submission can be found in smb://pcserv.ebi.ac.uk/sp-pro6/intact/local/data/curation-material/2019/thakur-2019 Additional construct details have been provided by the authors upon request. jthakur@nipgr.ac.in Accepted 2019-MAR-15 AT 16:24 GMT AT 16:24 GMT by MGT Nucleic acids research 2019 Only protein-protein interactions imex curation imex curation Fig S5:omitted Med4 asBait-Med31 as Prey. could it be added to Expt-2? could be added to EBI-21254668. Pablo: added to EBI-21254668 Figure S6A EBI-21254461: I would have added 1-78 as Required to Bind. Pablo: Added. Figure S8A/B:You have shown in EBI-21254509 the two fragments interacting - this is not shown experimentally as one construct is always Full length- should be 2 interactions, one of which is Supp fig 8A which has been omitted. (Bait= med14 Prey Med 10 and one construct was Suff. to bind 1-197 for S8A. (sorry - i cannot see the original files, as on laptop, so I hope what I have written makes sense.) Pablo: Duplicated, with figure legends corrected. Please can you remove the "on-hold"? I cannot remember what is meant to be done with that annotation and when?? Pablo: I cannot! It was there pre-publication but I do not seem to be able to take it away. I'll check with the developers and see if we can get rid of it if it is a problem for the release. med27_arath Mediator of RNA polymerase II transcription subunit 27 MED27 MED3 MED3_1 Mediator of RNA polymerase II transcription subunit 3 F3L24.5 MZB10.22 At3g09180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQTLHQSQLLQNPAEAANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQLFLREDASMRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHIDDGLKMEPSSKKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSDDPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFSPDEGGSYLHARGFSVYHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEAYHSSCSQDDT F780151B45FF3A11 med11_arath Mediator of RNA polymerase II transcription subunit 11 MED11 MED11_1 T13O15 At3g01435 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPQTQNTSLQRLQNVENRVVKVLELAGGVMEELASPSGPKKEFVNSHCREFMQSMKDIQVTLREEIKSACEYRPFEKCDYNARIANEICFQKLEYVLTQLEDLKQTADRYPSSD 0A667258161F58C6 md20a_arath Mediator of RNA polymerase II transcription subunit 20a MED20A MED20_1 T3B23.10 At2g28230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVKWVLHWQPNQGSTVSSQILNEATQCVESINGVKEGRWKATLNYYKPMLKDQANQLEFPRDFLGISLADQPNKYYFIIRTQRIVLEADSSIQLIMEKLQSYKSKVALYFDGFQYQLGDFRLRVGKVVPTHSENVRGIVMEVEYLPISSMEKAQKVMEEFLEIWNEALAKRSLPGKFVNIDLNFGEFGLGDIYTPQHTAVRYALVMAHMIATVQAVRG C3AC5D1BBA3936EC med6_arath Mediator of RNA polymerase II transcription subunit 6 MED6_1 MHC9 At3g21350 MED6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSSLLSAATADTFNGNAADQIPPPLQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFTDAASKLETIRQDLQVCLVAIVLSLSVNLGSYFLLIFKLMANGEQVYGFNKFLFDTENQNEPAESKPASETVDLKEMKRVDVILTSLYRKLAPPPPPPPFPEGYVSQEALGEKEELGTQGGESQPPQVDPIIDQGPAKRMKF DIP protein F4IXJ7 original sequence version: 22 000D39D2EDD7E4E7 md19a_arath Mediator of RNA polymerase II transcription subunit 19a MED19_1 MXC9.19 At5g12230 MED19A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEPERLKFGGPRELCGAADLISQFKLVQHHEFFCKKSLPVSLSDSHYLHNVVGDTEIRKGEGMQLDQLIESISQSRETNIRIQPFDIDELQESFQLNDMTPVELPPAEKGAPTIPSKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGDEDLNDVQRHKKNKHKSSKLDEVGAIRVAG DIP protein Q9FMP0 original sequence version: 56 177F2531AD9E599B med7a_arath Mediator of RNA polymerase II transcription subunit 7a MED7A MED7_1 F15A17.250 F9G14.160 At5g03220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATATYPPPPPYYRLYKDYSENPNSAPEPPPPIEGTYVCFGGNYTTEDVLPSLEEQGVPQLYPKDSNLDYKNELRSLNRELQLHILELADVLVDRPSQYAKRIGEISSIFKNLHHLLNSLRPHQARATLIHIMELQIQQRKQAVEDIKRRREEAQRLLKDAYLTLDGQ 65F18BBE9588207A med9_arath Mediator of RNA polymerase II transcription subunit 9 MED9_1 T7N22.3 At1g55080 MED9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQFSGGGGNWSMIPNVQAQGNFGTPTNHDQQLFLQQQQLQQQQQQQQQQQFHLQQQQQTQQQQQQFQPQQQQEMQQYQQFQQQQHFIQQQQFQQQQRLLQSPPLQPQSLQSPPPQQTMVHTPQSMMHTPQQQQQLVQTPVQTPQQHQSLASHFHLYPMVEKLADVIENGTRDQNSDALVNELNSHFDKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEYRKSIEEIVTMEH BF795E4ED4047FEE med4_arath Mediator of RNA polymerase II transcription subunit 4 MED4 MED4_1 F9G14.160 At5g02850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLQHQIVQSPARLGLTGPGSPSVQNPTPTRHGHPTSSSSSQSQHQQIQQQPNLLPSSTVAAASSASASAAVSSSALLSLLPPLPRAQALLQQMAVLTSKLFDVSPNRAIWLSAFRGSLPSFLSSHSLPPPPPLENPSPSSTKEILSQFNSLQTQLFEAVTELQEILDLQDAKQKVAREIKSKDSSLLAFANKLKDAERVLDMLVDDYSDYRKPKRSKIEEDDEDNDNESSSSSTTVSSQLKLKDILAYAHKISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYTFADLDIGLPKTVENMEKKVEALIEPPPPPEAMDISAIHNLLPPNIAVPSGWKPGMPVELPRDLPLPPPGWKPGDPVVLPPLESIAAPRAEDHQHMRPSQGLHRPPDVIQVRAVQLDILEDDDSSDYSSDDASSDDED 4AC6A38586479FCE med18_arath Mediator of RNA polymerase II transcription subunit 18 MED18 MED18_1 F14M13.23 At2g22370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSMECVVQGIIETQHVEALEILLQGLCGVQRERLRVHELCLRSGPNLGVVSSEVRLLCDLDQPEPTWTVKHVGGAMRGAGADQISVLVRNMIESKVSKNALRMFYALGYKLDHELLKVGFAFHFQRTAHISVSVSSVNKMPKVHAIDEAVPVTPGMQIVDVTAPATSENYSEVAAAVSSFCEFLAPLVHLSKPSISTGVVPTAAAAAASLMSDGGGTTL FE53D1C081F36F55 med17_arath Mediator of RNA polymerase II transcription subunit 17 MED17 MED17_1 F5O24.60 At5g20170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSDMEISLDRLPIKRLESIEENGAERFPSDVDYDDKRVSLIRRIDFAWALEEEDELKKKKQKKSSKDSVEQWKWKGMVENLQLAHQELTVIIDLIDTVQANDAVTVAGMTRPKPMPNEILSDLAVSTATKLQGYRNLGNYFKQSAKALEQKINREARFYGALIRLQRNWKVKRQRMLASNASNEGFTIDLSDSSLYDPTSGFRPSTLSTIRVDHDSAGMLAINVPQDSWYSLRFGYVGLNPIGNSNESDEHIDSTTGHDIPGTSEKLSASDDKYVKETHSLLREVHKSIFAEQLFDMLNREAFNEGVGFNISGLRENFMEMSIGQGASLFVSLHPSGKNPSIKKSESATLLIESSGRVEPAEGGDYRLKKLGFPNRTSYEIYLQQIFHEHAFGKAKDQLKSKSIRASNQTEKDSNSGLLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQGRSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSINKYECDVADLPVMILQQVASQIVCWLLEEARTVGTKASREFLSLSLEIVEGERVSLVAHVNPEDAKGCISWWLVMENGCTEEREGVSESRKLLGHLSLDVLYSVLMDLINLCGTGRNALERL D06CDC043C9AA5AD med32_arath Mediator of RNA polymerase II transcription subunit 32 MED32 MED2 MED29 MED2_1 Mediator of RNA polymerase II transcription subunit 2 F25C20.9 At1g11760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNIVDSLNKAYEKFVLASAGVLESKESAGGQKALLTDTALENFKEKWELFRVACDQAEEFVESVKQRIGSECLVDEATGLTTTAAGGQAPAAVTGAATSLPPISAVRLEQMSRAVRWLVLELQRGSGVAPGSVHSSSTGFDSRFSEDSTQ 9D2B07AECF1C9F30 md10a_arath Mediator of RNA polymerase II transcription subunit 10a MED10_2 MJC20.1 At5g41910 MED10A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQTQNTIAGIGEINGSIKTEINAIATVDDSNEKLNQIINSNQKILELLHQLKLTVSSFTPASQLHLLQRLNSLVMELDNMAKLSDKCNIQVPIEVLNLIDDGKNPDEFTKDVLNKNCIAKNQVTKGKSDAFKGLRKHLLEELEQAFPDEVDRYRDIRASYAAEAKRLAQTQSVLPNGDAKVKSEL F0D36D9DAC5DC160 md15a_arath Mediator of RNA polymerase II transcription subunit 15a MED15A MED15_2 F7H2.12 At1g15780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNWRPSLPNGEPAMDTGDWRTQLPPDSRQKIVNKIMETLKKHLPFSGPEGINELRRIAARFEEKIFSGALNQTDYLRKISMKMLTMETKSQNAAGSSAAIPAANNGTSIDSIPTNQGQLLPGSLSTNQSQAPQPLLSQTMQNNTASGMTGSTALPSSMPPVSSITNNNTTSVVNQNANMQNVAGMLQDSSGQHGLSSNMFSGPQRQMLGRPHAMSSQQQQQPYLYQQQLQQQLLKQNFQSGNVPNPNSLLPSHIQQQQQNVLQPNQLHSSQQPGVPTSATQPSTVNSAPLQGLHTNQQSSPQLSSQQTTQSMLRQHQSSMLRQHPQSQQASGIHQQQSSLPQQSISPLQQQPTQLMRQQAANSSGIQQKQMMGQHVVGDMQQQHQQRLLNQQNNVMNIQQQQSQQQPLQQPQQQQKQQPPAQQQLMSQQNSLQATHQNPLGTQSNVAGLQQPQQQMLNSQVGNSSLQNNQHSVHMLSQPTVGLQRTHQAGHGLYSSQGQQSQNQPSQQQMMPQLQSHHQQLGLQQQPNLLQQDVQQRLQASGQVTGSLLPPQNVVDQQRQLYQSQRTLPEMPSSSLDSTAQTESANGGDWQEEVYQKIKSMKETYLPDLNEIYQRVAAKLQQDSMPQQQRSDQLEKLRQFKTMLERMIQFLSVSKSNIMPALKDKVAYYEKQIIGFLNMHRPRKPVQQGQLPQSQMQPMQQPQSQTVQDQSHDNQTNPQMQSMSMQGAGPRAQQSSMTNMQSNVLSSRPGVSAPQQNIPSSIPASSLESGQGNTLNNGQQVAMGSMQQNTSQLVNNSSASAQSGLSTLQSNVNQPQLSSSLLQHQHLKQQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQARQQAAQLQQMNDMNDLTSRQGMNVSRGMFQQHSMQGQRANYPLQQLKPGAVSSPQLLQGASPQMSQHLSPQVDQKNTVNKMGTPLQPANSPFVVPSPSSTPLAPSPMQVDSEKPGSSSLSMGNIARQQATGMQGVVQSLAIGTPGISASPLLQEFTSPDGNILNSSTITSGKPSATELPIERLIRAVKSISPQALSSAVSDIGSVVSMVDRIAGSAPGNGSRASVGEDLVAMTKCRLQARNFMTQEGMMATKKMKRHTTAMPLSVASLGGSVGDNYKQFAGSETSDLESTATSDGKKARTETEHALLEEIKEINQRLIDTVVEISDDEDAADPSEVAISSIGCEGTTVRFSFIAVSLSPALKAHLSSTQMSPIQPLRLLVPCSYPNGSPSLLDKLPVETSKENEDLSSKAMARFNILLRSLSQPMSLKDIAKTWDACARAVICEYAQQFGGGTFSSKYGTWEKYVAAS md22b_arath Mediator of RNA polymerase II transcription subunit 22b MED22_1 T6D22.4 At1g07950 MED22B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNKGGGSGGGSGGGSGPTAAAAAAALQKQKALLQRVETDITSVVDNFTQIVNVSRVSDPPVKNSQETYMMEMRASRMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRIEEFDQEAEKTNRLLARIADDASANLKELESHYYSSAQRLTLDI B456EE8594840519 med14_arath Mediator of RNA polymerase II transcription subunit 14 MED14 MED14_1 Protein STRUWWELPETER SWP F7O18.23 At3g04740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAELGQQTVDFSALVGRAAEESFLSFKELVDKSKSTELSDTEKKVSLLKYVAKTQQRMLRLNALAKWCKQVPLINYFQDLGSTLSAHDICFTQAADSLFFMHEGLQQARAPVYDVPSAVEILLTGSYQRLPKCLDDVGMQSSLDEHQQKPALRKLEVLVRSKLLEITLPKEITEVKISKGTVTLSVDGEFKVLVTLGYRGHLSMWRILHLDLLVGERSGPIKLEVTRRHILGDDLERRMSVAENPFTILYAVLHELCVAIVMDTVIRQVRALLQGRWKDAIRFDLISDTGTTPANQEGEADSVSLRTPGMKLFYWSDSDKNSGPFIKIEPGSDLQIKCSHSTFVIDPLTGKEAEFSLDQSCIDVEKLLLKAICCNRYTRLLEIQKELLRNTRICRTPSDVILQALLDEPGIEGDNMVDSKERVEPEVLRVRAYGSSFFTLGINIRTGRFLLQSSKSILTSSILEEFEDALNQGSISAVDAFINLRSKSILHFFAAIGKFLGLEVYEHGFGINKVPKSLLDGSSILTLGFPDCESSHLLLMELEKDFTPLFKLLETQMDGSGKPQSFNDPSNILRAKKIDIGQIRILEDDLNLITSDVVKFVSSFSDAEGINQASGHRQPGLVDEALTEMSGSQLSFSSVVDGVFGLQKVTSALMSIDGHGLVPKNLSAVTGHGKAPMLTSYHSDSLYNRQGPLQSSSYNMLSSPPGKGSAMKKIAISNSDQELSLILSPSLSTGNGVSESGSRLVTESSLSPLPLSQTADLATSSAGPLLRKDQKPRKRSASDLLRLIPSLQVVEGVASPNKRRKTSELVQSELVKSWSPASQTLSTAVSTSTKTIGCSYGNLIAEANKGNAPSSVFVYALLHVVRHSSLSIKHAKLTSQMEALDIQYVEEMGLRDAFSDIWFRLPFAQNDSWQHICLQLGRPGSMCWDVKINDQHFRDLWELQKGSKTTPWGSGVHIANSSDVDSHIRYDPEGVVLSYQSVEADSIKKLVADIQRLSNARMFSLGMRKLLGIKPDEKTEECSANSTMKGSTGGKGSGEPVDRWRAFKIEAVGLTSLWFSFGSGVLARFVVEWESGKDGCTMHVSPDQLWPHTKFLEDFINGAEVESLLDCIRLTAGPLHALAAATRPARASTATGMPVVPATASSRQSNQIQQTQGIIAPSTLAAPNATGQSASATSGNTVASSAPSPLGGGFHGVAMLAAAGRSGPGIVPSSLLPIDVSVVLRGPYWIRIIYRKRFAVDMRCFAGDQVWLQPATPPKGGASIGGSLPCPQFRPFIMEHVAQELNGLEPNLTGSQGATNPNSGNPTVNGVNRVNFSPSSARAAMNRVASVASGSLVVSSGLPVRRTPGTAVPAHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLREILGSILKDNEGALLNLDQEQPALRFFVGGYVFAVSVHRVQLLLQVLSVRRFHHQAQQNGSSAAAQEELTQSEIGEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFLKLIAWKKGLSQSQQAGEIAPAQRPRIELCLENHSGTDLDNNCAAKSNIHYDRPHNTVDFALTVVLDPVHIPHINAAGGAAWLPYCVSVRLRYTFGENPSVTFLGMEGSHGGRACWQRVDDWEKCKQRVSRTVEVNGSAAGDLTQGKLKLVADSVQRTLHLCLQGLREGGNNNNNTHQKEFTI 5C68D7E02FB66A39 med31_arath Mediator of RNA polymerase II transcription subunit 31 MED31 MED31_1 Mediator complex subunit 31 Mediator complex subunit SOH1 F28I16.60 At5g19910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASPEEMGDDASEIPSPPKNTYKDPDGGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVPPQPPVAPSTSLPPAPSATAALSPALSPMQYNNMLSKNDTRNMGATGIDRRKRKKGI 706E3EB75C8F0A19 med21_arath Mediator of RNA polymerase II transcription subunit 21 Mediator complex subunit 21 RNAPII complex component SRB7 MED21 MED21_1 SRB7 T4B21.7 At4g04780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIISQLQEQVNTIAAITFNAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE med6-med11-1 1 Med11 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med6 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med6-med6-1 1 Med6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med6 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med6-med14-1 1 Med14 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med6 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med31-med9-1 1 Med9 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med31 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S5 med31-med6-1 1 Med6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med31 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med31-med4-1 1 Med4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med31 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl fig. S6A med32-med27-1 1 Med3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med2 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl fig. S6C med32-med15a-1 1 Med15A 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med2 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med14-med17-1 1 Med17 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med14 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3A, Supp. Figure 8A med14-med10a-1 1 Med10A 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med14 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S8B med14-med6-1 1 Med6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med14 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Suppl. figure S8A The full length of Med14 did not show any binding, the interaction was only detected with non-full length fragment(s). med15a-med15a-1 1 Med15A 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med15A 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med7a-med10a-1 1 Med10A 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med7A 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Suppl. figure S6B The full length of Med10A did not show any binding, the interaction was only detected with non-full length fragment(s). med11-med6-1 1 Med6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med11 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med11-med22b-1 1 Med22B 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Med11 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S4B med17-med17-1 1 Med17 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med17-med11-7 1 Med11 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med10a-1 1 Med10A 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S8B med17-med6-1 1 Med6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med22b-1 1 Med22B 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3A, C med17-med4-1 1 Med4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med17-med18-1 1 Med18 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3C The full length of Med17 did not show any binding, the interaction was only detected with non-full length fragment(s). med17-med14-1 1 Med14 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med17 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med18-med20a-1 1 Med20 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Med18 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S4D med19a-med19a-1 1 Med19A 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med19A 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med20a-med18-1 1 Med18 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med20 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S4C med22b-med11-1 1 Med11 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med22B 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S4A med4-med31-1 1 Med31 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med4 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S5 med4-med10a-1 1 Med10A 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med4 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Suppl. figure S6B The full length of Med10A did not show any binding, the interaction was only detected with non-full length fragment(s). med4-med9-1 2 Med9 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med4 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Figure S5 med4-med4-1 2 Med4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med4 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supplementary Figure S5 med10a-med32-1 1 Med2 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med10A 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A med10a-med10a-1 1 Med10A 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med10A 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S5 med10a-med7a-1 1 Med7A 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med10A 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl. fig. S5 med10a-med4-1 1 Med4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Med10A 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Figure 3A, suppl fig. S6A, suppl. fig. S5 med11-med22b-2 3 Med22B 17 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med11 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med18-med20a-2 3 Med20 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med18 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med21-med7a-1 3 Med21 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med7A 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med21-med9-1 3 Med21 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med9 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med31-med9-2 3 Med31 19 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med9 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med4-med9-2 3 Med9 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med4 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med31-med7a-1 3 Med31 19 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med7A 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med27-med32-1 3 Med3 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med2 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med15a-med32-1 3 Med15A 16 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range Med2 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N-terminal region nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3B med10a-med14-1 1 Med10 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Med14 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3A, suppl. fig. S8A