DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures and operating principles of the replisome. Structures and operating principles of the replisome. Science (New York, N.Y.) 2019 imex curation Gao Y., Cui Y., Fox T., Lin S., Wang H., de Val N., Zhou ZH., Yang W. wei.yang@nih.gov 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gao Y., Cui Y., Fox T., Lin S., Wang H., de Val N., Zhou ZH., Yang W. wei.yang@nih.gov Accepted 2019-MAY-16 AT 08:51 BST AT 08:51 BST by ORCHARD Science (New York, N.Y.) 2019 imex curation Structures and operating principles of the replisome. Structures and operating principles of the replisome. Science (New York, N.Y.) 2019 imex curation Gao Y., Cui Y., Fox T., Lin S., Wang H., de Val N., Zhou ZH., Yang W. wei.yang@nih.gov 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Gao Y., Cui Y., Fox T., Lin S., Wang H., de Val N., Zhou ZH., Yang W. wei.yang@nih.gov Accepted 2019-MAY-16 AT 08:51 BST AT 08:51 BST by ORCHARD Science (New York, N.Y.) 2019 imex curation helic_bpt7 DNA helicase/primase Gene product 4 4 protein protein bpt7 Enterobacteria phage T7 Bacteriophage T7 MDNSHDSDSVFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTAGNEDTKERASKRKPSGGKPMTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSGEEESHSESTDWSNDTDF mint DNA primase synthesizes RNA primers necessary for replication by DNA polymerase. It also functions as an ATP-dependent unwinding protein. Has a 5'->3' helicase activity; 4a also has a DNA primase activity C808C3663FEBE5AA q14f07_ecolx trxA protein protein ecolx Escherichia coli MLYESVSGEIKSTFSWLMLHQQRNQHARLIPVELYMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA B96CC763C74DA44E dpol_bpt7 DNA-directed DNA polymerase Gene product 5 5 protein protein bpt7 Enterobacteria phage T7 Bacteriophage T7 MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHNGHKYDVPALTKLAKLQLNREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGKRFGSHALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEEMMDYNVQDVVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVELAARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQREGREPCELDTREYVAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAWLRYVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKERGKELKKKFLENTPAIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSPHAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH DIP protein P00581 original sequence version: 85 mint 17089CE2AD9FB596 dpol_bpt7-prim_bpt7-1 2 3 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified P03692:p.Glu343Gln E343Q mutation mutation certain certain sequence position certain certain certain sequence position certain E Q Tue Jun 30 16:22:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu343Gln' ecoli Escherichia coli (strain K12) 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified P00581:p.Asp5Ala D5A mutation mutation certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 17:22:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp5Ala' P00581:p.Glu7Ala E7A mutation mutation certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 19:04:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu7Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.1, Fig. S5, Table S1 dpol_bpt7-trxa-3 2 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified P00581:p.Asp5Ala D5A mutation mutation certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 17:38:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp5Ala' P00581:p.Glu7Ala E7A mutation mutation certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 18:59:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu7Ala' ecoli Escherichia coli (strain K12) 4 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. S8E, S9B, Table S1 Stoichiometry remained unspecified since they are fragments of a bigger complex. prim_bpt7-prim_bpt7-1 1 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified P03692:p.Glu343Gln E343Q mutation mutation certain certain sequence position certain certain certain sequence position certain E Q Tue Jun 30 17:01:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu343Gln' ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified P03692:p.Glu343Gln E343Q mutation mutation certain certain sequence position certain certain certain sequence position certain E Q Tue Jun 30 19:44:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu343Gln' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.1B Complex formed in the presence of single-stranded DNA