UniProt UniProt http://www.uniprot.org Role of tau N-terminal motif in the secretion of human tau by End Binding proteins. Role of tau N-terminal motif in the secretion of human tau by End Binding proteins. PloS one 2018 imex curation Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es Accepted 2019-JUL-01 AT 13:07 BST AT 13:07 BST by MGT PloS one 2018 Only protein-protein interactions imex curation imex curation Role of tau N-terminal motif in the secretion of human tau by End Binding proteins. Role of tau N-terminal motif in the secretion of human tau by End Binding proteins. PloS one 2018 imex curation Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Sayas CL., Medina M., Cuadros R., Ollá I., García E., Pérez M., Ferrer I., Hernández F., Avila J. javila@cbm.csic.es Accepted 2019-JUL-01 AT 13:07 BST AT 13:07 BST by MGT PloS one 2018 Only protein-protein interactions imex curation imex curation mare3_human Microtubule-associated protein RP/EB family member 3 End-binding protein 3 EB1 protein family member 3 RP3 MAPRE3 protein protein human Homo sapiens Human MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY DIP protein Q9UPY8 original sequence version: 128 DIP protein Q9UPY8-1 original sequence version: 109 0DA45E89A0B993D3 tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636 original sequence version: 125 DIP protein P10636 original sequence version: 210 D46C66CDBCD196E8 mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY DIP protein Q15691 original sequence version: 154 DIP protein Q15691 original sequence version: 151 DIP protein Q15691 original sequence version: 143 DIP protein Q15691 original sequence version: 84 08C8999F45A145ED mapt-mapre3-2 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association Fig.2A-C mapt-mapre3-1 2 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] association association Fig.2D Only very low amounts of MAPRE1 detected mapt-mapre3-3 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association Fig.3A