MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. International journal of cancer 2019 imex curation Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. Nine of 10 potential interactors generated a fluorescent signal in PLA (Suppl. Fig. 1) and 8 of 10 in BiFC (Suppl. Fig. 2). The most pronounced signal in both assays was generated with FLOT1, HTATIP2, RAP2A and PLP2 (Fig. 4, summary of interactions shown in Suppl. Fig. 1 and 2). The fluorescent signal was detectable in different compartments of the cell, mainly in the cytoplasmic and membrane compartments. RAB10-EMP3 association was only detected with PLA (Suppl. Fig. 1). send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de Accepted 2019-MAR-07 AT 18:40 GMT AT 18:40 GMT by LUANA International journal of cancer 2019 Only protein-protein interactions imex curation imex curation Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. International journal of cancer 2019 imex curation Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de Accepted 2019-MAR-07 AT 18:40 GMT AT 18:40 GMT by LUANA International journal of cancer 2019 Only protein-protein interactions imex curation imex curation Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. Characterization of the Epithelial Membrane Protein 3 interaction network reveals a potential functional link to mitogenic signal transduction regulation. International journal of cancer 2019 imex curation Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-c32 C32 melanoma cell line, amelanotic (colourless) Human c32 C32 melanoma cell line, amelanotic (colourless) https://www.lgcstandards-atcc.org/products/all/CRL-1585 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. Nine of 10 potential interactors generated a fluorescent signal in PLA (Suppl. Fig. 1) and 8 of 10 in BiFC (Suppl. Fig. 2). The most pronounced signal in both assays was generated with FLOT1, HTATIP2, RAP2A and PLP2 (Fig. 4, summary of interactions shown in Suppl. Fig. 1 and 2). The fluorescent signal was detectable in different compartments of the cell, mainly in the cytoplasmic and membrane compartments. RAB10-EMP3 association was only detected with PLA (Suppl. Fig. 1). send email to authors for origin species of protein and cDNA library used in the experiments. all human genes. stefan.pusch@med.uni-heidelberg.de Accepted 2019-MAR-07 AT 18:40 GMT AT 18:40 GMT by LUANA International journal of cancer 2019 Only protein-protein interactions imex curation imex curation bsdc1_human BSD domain-containing protein 1 BSDC1 UNQ2494/PRO5781 protein protein human Homo sapiens Human MAEGEDVGWWRSWLQQSYQAVKEKSSEALEFMKRDLTEFTQVVQHDTACTIAATASVVKEKLATEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYCNEPDGPPELFDAWLSQFCLEEKKGEISELLVGSPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQRAEQSISEEPGWEEEEEELMGISPISPKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESSESISLVTQIANPATAPEARVLPKDLSQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRPPARVETLREEAPTDLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWE 4031A3DC18A33646 rap2a_human Ras-related protein Rap-2a RbBP-30 RAP2A protein protein human Homo sapiens Human MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ 047D49762765F0B7 rab10_human Ras-related protein Rab-10 RAB10 protein protein human Homo sapiens Human MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC 7F02B8E8E46EE1E8 ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL DIP protein P26678 original sequence version: 151 0766304A76A854D3 vamp3_human Vesicle-associated membrane protein 3 Synaptobrevin-3 Cellubrevin VAMP3 SYB3 protein protein human Homo sapiens Human MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS DIP protein Q15836 original sequence version: 141 347E9163157AFF42 tmm51_human Transmembrane protein 51 TMEM51 C1orf72 protein protein human Homo sapiens Human MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD C0CC36D41C57157C emp3_human Epithelial membrane protein 3 EMP3 YMP Hematopoietic neural membrane protein 1 Protein YMP protein protein human Homo sapiens Human MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE 2B5DF55938825940 plp2_human Proteolipid protein 2 Intestinal membrane A4 protein Differentiation-dependent protein A4 PLP2 A4 protein protein human Homo sapiens Human MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV 689378A8C326206C flot1_human Flotillin-1 FLOT1 protein protein human Homo sapiens Human MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA C69E5421E565F53A cklf5_human CKLF-like MARVEL transmembrane domain-containing protein 5 CMTM5 CKLFSF5 Chemokine-like factor superfamily member 5 protein protein human Homo sapiens Human MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ 26AC880FFC8E1F50 htai2_human Oxidoreductase HTATIP2 HTATIP2 30 kDa HIV-1 TAT-interacting protein CC3 HIV-1 TAT-interactive protein 2 TIP30 protein protein human Homo sapiens Human MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP 6A26E4A095243678 emp3-flot1-1 2 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-htatip2-1 2 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-pln-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-plp2-1 2 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-cmtm5-1 2 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-vamp3-1 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-tmem51-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-bsdc1-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-rap2a-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 emp3-rab10-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association table 1 bsdc1-emp3-1 3 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction suppl fig 1 emp3-rab10-2 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction suppl fig 1 emp3-htatip2-2 3 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction fig 4a suppl fig 1 emp3-plp2-2 3 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction fig 4a; suppl fig 1 emp3-flot1-2 3 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction fig 4a, suppl fig 1 emp3-rap2a-2 3 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction fig 4a, suppl fig 1 cmtm5-emp3-1 3 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction suppl fig 1 emp3-vamp3-2 3 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction suppl fig 1 emp3-tmem51-2 3 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction suppl fig 1 emp3-htatip2-3 1 14 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association fig 4a suppl fig 2 emp3-plp2-3 1 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association fig 4b; suppl fig 2 emp3-flot1-3 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association fig 4a, suppl fig 2 emp3-rap2a-3 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association fig 4a, suppl fig 2 emp3-tmem51-3 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association suppl fig 1 emp3-vamp3-3 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association suppl fig 2 bsdc1-emp3-2 1 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association suppl fig 1 cmtm5-emp3-2 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association suppl fig 2