IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CHCHD10 is involved in the development of Parkinson's disease caused by CHCHD2 loss-of-function mutation p.T61I. CHCHD10 is involved in the development of Parkinson's disease caused by CHCHD2 loss-of-function mutation p.T61I. Neurobiology of aging 2019 imex curation Mao C., Wang H., Luo H., Zhang S., Xu H., Zhang S., Rosenblum J., Wang Z., Zhang Q., Tang M., Shepard MJ., Wang X., Wang Y., Zhuang Z., Shi C., Xu Y. shichanghe@gmail.com,xuyuming@zzu.edu.cn 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mao C., Wang H., Luo H., Zhang S., Xu H., Zhang S., Rosenblum J., Wang Z., Zhang Q., Tang M., Shepard MJ., Wang X., Wang Y., Zhuang Z., Shi C., Xu Y. shichanghe@gmail.com,xuyuming@zzu.edu.cn Accepted 2019-MAY-23 AT 11:04 BST AT 11:04 BST by LIVIAP Neurobiology of aging 2019 Only protein-protein interactions imex curation imex curation chc10_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial Protein N27C7-4 CHCHD10 C22orf16 protein protein human Homo sapiens Human MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP A3AA3894CBEC0137 chch2_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 CHCHD2 C7orf17 HCV NS2 trans-regulated protein Aging-associated gene 10 protein AAG10 protein protein human Homo sapiens Human MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA 5403662D8DB4FB86 chchd10-chchd2-3 1 2 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y6H1:p.Thr61Ile mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T I Tue Jun 30 19:45:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr61Ile' physical association physical association Figure 2c