IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutations in EPAS1 in congenital heart disease in Tibetans. Mutations in EPAS1 in congenital heart disease in Tibetans. Bioscience reports 2018 imex curation Pan H., Chen Q., Qi S., Li T., Liu B., Liu S., Ma X., Wang B. wbbahu@163.com,chqh666@aliyun.com,nicgr@263.net 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-ac16 human-ac16 cardiomyocyte cell ac16 ac16 human cardiomyocyte cell line cardiac_myocyte cardiac myocyte gal4 vp16 complement gal4 vp16 complementation karyoplasmic interaction ion strategy KISS mammalian two hybrid gal4 vp16 complement predetermined predetermined participant predetermined Pan H., Chen Q., Qi S., Li T., Liu B., Liu S., Ma X., Wang B. Interactions involving rare mutations in the EPAS1 coding sequence specific to Tibetan patients with non-syndromic congenital heart disease were investigated. wbbahu@163.com,chqh666@aliyun.com,nicgr@263.net Accepted 2019-AUG-23 AT 08:14 BST AT 08:14 BST by MGT Bioscience reports 2018 Only protein-protein interactions imex curation imex curation Interaction with PHD2 captured; Tags removed egln1_human Egl nine homolog 1 EGLN1 C1orf12 PNAS-118 PNAS-137 Hypoxia-inducible factor prolyl hydroxylase 2 Prolyl hydroxylase domain-containing protein 2 SM-20 protein protein human Homo sapiens Human MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF 81A97FF772CAA14C vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT DIP protein Q99814 original sequence version: 115 DIP protein Q99814 original sequence version: 155 DIP protein Q99814 original sequence version: 157 DIP protein Q99814 original sequence version: 137 DIP protein Q99814 original sequence version: 135 4838989598234FC1 epas1-vhl-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q99814:p.Asn203His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain N H Tue Jun 30 17:26:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn203His' Q99814:p.Gly724Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G W Tue Jun 30 15:36:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly724Trp' physical association physical association Figure 3b The assay was carried out under normoxic and hypoxic conditions. The N203H mutation enhanced protein–protein interactions between HIF2 and pVHL, especially in conditions of hypoxia. the N203H mutation enhanced protein–protein interactions between HIF2 and pVHL, especially in conditions of hypoxia. epas1-vhl-2 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q99814:p.Gly724Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G W Tue Jun 30 18:18:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly724Trp' Q99814:p.Asn203His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain N H Tue Jun 30 20:10:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn203His' physical association physical association Figure 3a The assay was carried out under normoxic and hypoxic conditions. The N203H mutation enhanced protein–protein interactions between HIF2 and PHD2, especially in conditions of hypoxia.