IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apolipoprotein A-I directly interacts with extracellular domain 1 of human ABCA1. Apolipoprotein A-I directly interacts with extracellular domain 1 of human ABCA1. Bioscience, biotechnology, and biochemistry 2019 imex curation Kawanobe T., Shiranaga N., Kioka N., Kimura Y., Ueda K. Sulfo-SBED (Sulfo-N-hydroxysuccinimidyl-2-(6-[biotinamido]-2-(p-azido benzamido)-hexanoamido) ethyl-1,3'-dithioproprionate) is a heterobifunctional chemical crosslinker capable of covalently attaching to primary amines at one end and to nearly any protein functional group at the other end. Figs 5 to end were not captured as no species of proteases/peptidases is available. ykimura@kais.kyoto-u.ac.jp,uedak@kais.kyoto-u.ac.jp 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Kawanobe T., Shiranaga N., Kioka N., Kimura Y., Ueda K. Sulfo-SBED (Sulfo-N-hydroxysuccinimidyl-2-(6-[biotinamido]-2-(p-azido benzamido)-hexanoamido) ethyl-1,3'-dithioproprionate) is a heterobifunctional chemical crosslinker capable of covalently attaching to primary amines at one end and to nearly any protein functional group at the other end. Figs 5 to end were not captured as no species of proteases/peptidases is available. ykimura@kais.kyoto-u.ac.jp,uedak@kais.kyoto-u.ac.jp Accepted 2020-FEB-13 AT 14:21 GMT AT 14:21 GMT by LIVIAP Bioscience, biotechnology, and biochemistry 2019 Only protein-protein interactions imex curation imex curation Apolipoprotein A-I directly interacts with extracellular domain 1 of human ABCA1. Apolipoprotein A-I directly interacts with extracellular domain 1 of human ABCA1. Bioscience, biotechnology, and biochemistry 2019 imex curation Kawanobe T., Shiranaga N., Kioka N., Kimura Y., Ueda K. Sulfo-SBED (Sulfo-N-hydroxysuccinimidyl-2-(6-[biotinamido]-2-(p-azido benzamido)-hexanoamido) ethyl-1,3'-dithioproprionate) is a heterobifunctional chemical crosslinker capable of covalently attaching to primary amines at one end and to nearly any protein functional group at the other end. Figs 5 to end were not captured as no species of proteases/peptidases is available. ykimura@kais.kyoto-u.ac.jp,uedak@kais.kyoto-u.ac.jp 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Kawanobe T., Shiranaga N., Kioka N., Kimura Y., Ueda K. Sulfo-SBED (Sulfo-N-hydroxysuccinimidyl-2-(6-[biotinamido]-2-(p-azido benzamido)-hexanoamido) ethyl-1,3'-dithioproprionate) is a heterobifunctional chemical crosslinker capable of covalently attaching to primary amines at one end and to nearly any protein functional group at the other end. "tag perox activity" added for detection of biotin labelled proteins as you cannot "do" a Western blot with Streptavidin. UV Photo-Cross linking with Sulfo-SBED-ApoA1. Crude cell membranes were analyzed. The linker-biotin moiety is only retained on ABCA1. Figs 5 to end were not captured as no species of proteases/peptidases is available. ykimura@kais.kyoto-u.ac.jp,uedak@kais.kyoto-u.ac.jp Accepted 2020-FEB-13 AT 14:21 GMT AT 14:21 GMT by LIVIAP Bioscience, biotechnology, and biochemistry 2019 Only protein-protein interactions imex curation imex curation abca1_human Phospholipid-transporting ATPase ABCA1 ATP-binding cassette transporter 1 Cholesterol efflux regulatory protein ABCA1 ABC1 CERP ATP-binding cassette sub-family A member 1 protein protein human Homo sapiens Human MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTGITPGSIELPHHVKYKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEKKTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHPGSNQKRISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGTLELLNALTKDPGFGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV DIP protein O95477 original sequence version: 70 DIP protein O95477 original sequence version: 169 21A2CF8F3F518D6D apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ DIP protein P02647 original sequence version: 116 DIP protein P02647 original sequence version: 125 DIP protein P02647 original sequence version: 147 DIP protein P02647 original sequence version: 162 1A28B8366E620310 abca1-apoa1-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Gly207 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain O95477:p.Arg1272_Arg1273insValProArgGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain RR RVPRGSR Tue Jun 30 19:35:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1272_Arg1273insValProArgGlySer' O95477:p.[Lys939Met;Lys1952Met] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K M certain certain sequence position certain certain certain sequence position certain K M Wed Jan 29 12:50:43 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys939Met;Lys1952Met' Tue Jun 30 18:24:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys939Met;Lys1952Met]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role neutral component neutral component purified purified region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) colocalization colocalization 2B abca1-apoa1-2 1 4 competitor competitor competitor neutral component neutral component purified purified s-bed_biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Gly207 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain O95477:p.Arg1272_Arg1273insValProArgGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain RR RVPRGSR Tue Jun 30 18:13:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1272_Arg1273insValProArgGlySer' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role neutral component neutral component purified purified region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) colocalization colocalization 2B abca1-apoa1-3 2 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified s-bed_biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 tag perox activity tag visualisation by peroxidase activity tag perox activity anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Gly207 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain O95477:p.Arg1272_Arg1273insValProArgGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain RR RVPRGSR Tue Jun 30 20:07:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1272_Arg1273insValProArgGlySer' O95477:p.[Lys939Met;Lys1952Met] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K M certain certain sequence position certain certain certain sequence position certain K M Wed Jan 29 11:24:14 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys939Met;Lys1952Met' Tue Jun 30 16:24:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys939Met;Lys1952Met]' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 3,4 abca1-apoa1-4 2 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp competitor competitor competitor neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified s-bed_biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 tag perox activity tag visualisation by peroxidase activity tag perox activity anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Gly207 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain O95477:p.Arg1272_Arg1273insValProArgGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain RR RVPRGSR Tue Jun 30 15:42:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1272_Arg1273insValProArgGlySer' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 4