UniProt UniProt http://www.uniprot.org Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Acta neuropathologica communications 2018 imex curation Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-brain Homo sapiens brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease I know we don't normally do self co-localizations, but feel the additional use of the anti-oligomer Ab makes this one acceptable. Brain tissue obtained from Alzheimer Disease and age-matched non-demented control subjects. Presence of aggregates was confirmed using an anti-beta-sheet oligomer antibody in addition to the protein-specific Abs. Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu Accepted 2019-NOV-28 AT 10:08 GMT AT 10:08 GMT by PPORRAS Acta neuropathologica communications 2018 Only protein-protein interactions imex curation imex curation Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Acta neuropathologica communications 2018 imex curation Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Presence of aggregates was confirmed using an anti-beta-sheet oligomer antibody in addition to the anti-bait Abs. Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu Accepted 2019-NOV-28 AT 10:08 GMT AT 10:08 GMT by PPORRAS Acta neuropathologica communications 2018 Only protein-protein interactions imex curation imex curation Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Acta neuropathologica communications 2018 imex curation Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu Accepted 2019-NOV-28 AT 10:08 GMT AT 10:08 GMT by PPORRAS Acta neuropathologica communications 2018 Only protein-protein interactions imex curation imex curation Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Acta neuropathologica communications 2018 imex curation Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-brain Homo sapiens brain brain Brain [cerebrum] confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease I know we don't normally do self co-localizations, but feel the additional use of the anti-oligomer Ab makes this one acceptable. Brain tissue obtained from Alzheimer Disease. Presence of aggregates was confirmed using an anti-beta-sheet oligomer antibody in addition to the protein-specific Abs. Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu Accepted 2019-NOV-28 AT 10:08 GMT AT 10:08 GMT by PPORRAS Acta neuropathologica communications 2018 Only protein-protein interactions imex curation imex curation Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Formation of Toxic Oligomeric Assemblies of RNA-binding Protein: Musashi in Alzheimer's disease. Acta neuropathologica communications 2018 imex curation Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R., Sengupta U., Montalbano M., McAllen S., Minuesa G., Kharas M., Kayed R. Alzheimers - Interactions investigated in the context of Alzheimers disease Source, isoform and purification of tau described in PMID:21047142, as referenced in the text. No description of the expression of MSI proteins was given. rakayed@utmb.edu Accepted 2019-NOV-28 AT 10:08 GMT AT 10:08 GMT by PPORRAS Acta neuropathologica communications 2018 Only protein-protein interactions imex curation imex curation tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636 original sequence version: 125 DIP protein P10636 original sequence version: 210 D46C66CDBCD196E8 msi1h_human RNA-binding protein Musashi homolog 1 MSI1 protein protein human Homo sapiens Human METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH 26487B0A32CF1F40 p10636-8 Microtubule-associated protein tau Tau-4 MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 2N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636-8 original sequence version: 206 DIP protein P10636-8 original sequence version: 203 DIP protein P10636-8 original sequence version: 166 DIP protein P10636-8 original sequence version: 218 835A8706D847A8CC msi2h_human RNA-binding protein Musashi homolog 2 MSI2 protein protein human Homo sapiens Human MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH 6E2FC929491748A2 msi1-1 2 7 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2A msi2-msi2-1 2 9 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2A msi2-msi2-2 5 9 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2B msi1-msi1-2 5 7 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2B mapt-msi1-1 3 7 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2C msi2-mapt-1 3 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2C msi2-msi2-4 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 3C Cytoplasmic accumulation of MSI2 oligomers was observed in AD brains but not the controls msi2-msi2-3 4 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Figs 4, 5 Cytoplasmic accumulation of MSI2 oligomers was observed in AD brains but not the controls mapt-msi2-1 1 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 6, 7 Observed in AD brains. Use of anti-beta-sheet oligomer antibody suggested MSI protein colocalised with tau oligomers. mapt-msi1-2 1 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 6, 7 Observed in AD brains. Use of anti-beta-sheet oligomer antibody suggested MSI protein colocalised with tau oligomers. mapt-msi1-3 3 7 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 1B mapt-msi2-2 3 9 unspecified role unspecified role prey prey purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 1A