IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. Journal of the American Heart Association 2017 imex curation Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. same experiment as Expt-2, (but added in separate experiment in an attempt to avoid getting in a muddle with peptide additions). Interactions without peptides have figure legends added in Expt-2, including CXCR4+A1D interaction- with NO effect of peptides. Peptides added as New interactors, as I could not find a suitable case as a "mutation/variant" in HGVS. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Accepted 2019-APR-25 AT 15:29 BST AT 15:29 BST by LIVIAP Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. Journal of the American Heart Association 2017 imex curation Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. Flag-ACKR3 has N-terminal tag, the only ACKR3 construct in Addgene- presumably this one. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Accepted 2019-APR-25 AT 15:29 BST AT 15:29 BST by LIVIAP Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. Journal of the American Heart Association 2017 imex curation Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Accepted 2019-APR-25 AT 15:29 BST AT 15:29 BST by LIVIAP Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. α1-Adrenergic Receptors Function Within Hetero-Oligomeric Complexes With Atypical Chemokine Receptor 3 and Chemokine (C-X-C motif) Receptor 4 in Vascular Smooth Muscle Cells. Journal of the American Heart Association 2017 imex curation Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Albee LJ., Eby JM., Tripathi A., LaPorte HM., Gao X., Volkman BF., Gaponenko V., Majetschak M. human hVSMCs:- primary (aortic) vascular smooth muscle cells HA‐tagged ACKR3, CXCR4 and alpha1a/b/d/‐AR subtypes, were of Human origin as no other tagged mammalian constructs could be found in the Addgene repository. mmajetschak@luc.edu Accepted 2019-APR-25 AT 15:29 BST AT 15:29 BST by LIVIAP Journal of the American Heart Association 2017 Only protein-protein interactions imex curation imex curation tm7_peptide TM7_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DDDLHVTQCLSLVHCCVNPVLYSFIN tm2_peptide TM2_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YILNLAIADLWVVLTIPVWVVDDD tm4_peptide TM4_peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VVCILWLLAFCVSLPDTYYLDD ada2b_human Alpha-2B adrenergic receptor ADRA2B ADRA2L1 ADRA2RL1 Alpha-2 adrenergic receptor subtype C2 Alpha-2B adrenoreceptor protein protein human Homo sapiens Human MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW DIP protein P18089 original sequence version: 155 06E43857152A68ED ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV DIP protein P35348 original sequence version: 126 1A50487531DECDF0 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 ada1d_human Alpha-1D adrenergic receptor Alpha-1D adrenoreceptor Alpha-1A adrenergic receptor Alpha-adrenergic receptor 1a ADRA1D ADRA1A protein protein human Homo sapiens Human MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAGSGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVPPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRETDI EBEB134CF20A4988 ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK A863EC1AFB5B158B ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF DIP protein P35368 original sequence version: 106 F081A23D2F943F7F ackr3-adra1a-1 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3-1 ackr3-adra1b-1 2 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3-2 ackr3-adra1b-2 2 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3-3 ackr3-adra1d-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3-4 ackr3-cxcr4-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3-5 9-ipojk;-1 3 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 A/B, 5A-C, 7+8 A-D siRNA knockdown of ACKR3 significantly reduced PLA signals. siRNA knockdown of ACKR3 significantly reduced ACKR3:a1B/D‐AR and ACKR3:CXCR4 interactions but did not affect ACKR3:a1A‐AR or CXCR4:a1A‐AR interactions ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-cxcr4-2 3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 5A-C, 6A/C,8 B/D siRNA knockdown of ACKR3 did not significantly reduce PLA signals. ackr3-adra1a-2 3 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 A/B, 5A-C, 6B/D, 7 +8 A-D siRNA knockdown of ACKR3 or CXCR4 significantly reduced PLA signals. TM peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-adra1b-3 3 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 A/B, 5A-C, 6B/D, 7+8 A-D siRNA knockdown of ACKR3 or CXCR4 significantly reduced PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) ackr3-adra1d-2 3 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 A/B-5 We detected positive PLA signals for interactions between ACKR3 and a1A/B/D‐AR and between ACKR3 and a2B‐AR in hVSMCs. ackr3-adra1a-3 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 4D-G ackr3-adra1a-4 3 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4A-B, 5A-C, 6B/D, 7+8 A-D siRNA knockdown of ACKR3 or CXCR4 did not significantly reduce PLA signals. ACKR3 Trans-Membrane peptide analogs did not significantly affect the number of PLA signals for ACKR3, a1A/B/D‐AR, or CXCR4 (Figure 8A) adra1d-cxcr4-1 3 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 6 A/C, 8 B/D siRNA knockdown of ACKR3 significantly reduced PLA signals. Addition of all TM peptides had NO effect on this interaction. adra1d-cxcr4-2 3 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 6 A/C, 7+8 A-D siRNA knockdown of ACKR3 significantly reduced PLA signals. ackr3-adra1a-5 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -2 The TM7 peptide analog significantly increased PLA signals. TM4 and 2 had no effect. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) ackr3-ackr3-1 1 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -1 The TM2 peptide analog significantly reduced PLA signals; TM4 and 7 had no effect. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-adra1d-3 1 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -3 The TM2 and TM4 peptide analogs significantly reduced PLA signals; TM7 had no effect. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-adra1b-4 1 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -4 The TM2 and TM4 peptide analogs significantly reduced PLA signals; TM7 had no effect. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) ackr3-adra1d-4 1 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -5 All TM peptide analogs significantly reduced PLA signals. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) ackr3-cxcr4-3 1 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -6 All TM peptide analogs significantly reduced PLA signals. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) ackr3-cxcr4-4 1 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 competitor competitor competitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -7 All TM peptide analogs significantly reduced PLA signals. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) ackr3-adra1a-6 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -8 All peptide analogs significantly increased PLA signals. TM7 - peptide (DDDLHVTQCLSLVHCCVNPVLYSFIN) adra1a-cxcr4-1 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -9 All peptide analogs significantly increased PLA signals. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD) adra1a-cxcr4-2 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -10 All peptide analogs significantly increased PLA signals. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) adra1a-cxcr4-3 1 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -11 All peptide analogs significantly increased PLA signals;however addition of the TM7 peptide did not achieve the P<0.05 significance level. TM2 - peptide (YILNLAIADLWVVLTIPVWVVDDD) adra1b-cxcr4-1 1 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 stimulator stimulator neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) proximity proximity close-contact colocalization neighbourhood interaction Figure 7+8 B/D -12 All peptide analogs significantly increased PLA signals;however addition of the TM7 peptide did not achieve the P<0.05 significance level. TM4 - peptide (VVCILWLLAFCVSLPDTYYLDD)