IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Transcription Factor IRF6 Co-Represses PPARγ-Mediated Cytoprotection in Ischemic Cerebrovascular Endothelial Cells. The Transcription Factor IRF6 Co-Represses PPARγ-Mediated Cytoprotection in Ischemic Cerebrovascular Endothelial Cells. Scientific reports 2017 imex curation Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-cerebrovascular_endothelium mouse cerebrovascular endothelial cells cerebrovascular_endothelium cerebrovascular endothelial cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com Accepted 2019-FEB-07 AT 14:36 GMT AT 14:36 GMT by PPORRAS Scientific reports 2017 Only protein-protein interactions imex curation imex curation The Transcription Factor IRF6 Co-Represses PPARγ-Mediated Cytoprotection in Ischemic Cerebrovascular Endothelial Cells. The Transcription Factor IRF6 Co-Represses PPARγ-Mediated Cytoprotection in Ischemic Cerebrovascular Endothelial Cells. Scientific reports 2017 imex curation Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-cerebrovascular_endothelium mouse cerebrovascular endothelial cells cerebrovascular_endothelium cerebrovascular endothelial cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang R., Hu Z., Feng Y., Yu L., Li X. lxs2858@163.com Accepted 2019-FEB-07 AT 14:36 GMT AT 14:36 GMT by PPORRAS Scientific reports 2017 Only protein-protein interactions imex curation imex curation irf6_mouse Interferon regulatory factor 6 Irf6 protein protein mouse Mus musculus Mouse MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEGVDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQTQGSVINPGSTGSAPWDEKDNDVDEDEEEDELEQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPESVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLAAPNLIERQKKVKLFCLETFLSELIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPAPSMQLPQALPAQ 1C564BC8D79C5259 pparg_mouse Peroxisome proliferator-activated receptor gamma Pparg Nr1c3 Nuclear receptor subfamily 1 group C member 3 protein protein mouse Mus musculus Mouse MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY AB8F3F6086E2A10A mir106a_mouse_gene Mir106a mouse gene gene gene mouse Mus musculus Mouse irf6-pparg-1 2 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig: 1b irf6-1 2 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig: 1b pparg-11 1 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level putative PPRE site miR-106a promoter sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Promoter position: −2262/−2248. 4 unspecified role unspecified role bait bait living cell living cell expression modif expression level alteration expression modif physical association physical association 6C, D