DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for lipopolysaccharide extraction by ABC transporter LptB2FG. Structural basis for lipopolysaccharide extraction by ABC transporter LptB2FG. Nature structural & molecular biology 2017 imex curation Luo Q., Yang X., Yu S., Shi H., Wang K., Xiao L., Zhu G., Sun C., Li T., Li D., Zhang X., Zhou M., Huang Y. yihuahuang@sun5.ibp.ac.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Luo Q., Yang X., Yu S., Shi H., Wang K., Xiao L., Zhu G., Sun C., Li T., Li D., Zhang X., Zhou M., Huang Y. yihuahuang@sun5.ibp.ac.cn Accepted 2019-APR-30 AT 10:08 BST AT 10:08 BST by ORCHARD Nature structural & molecular biology 2017 imex curation From the first paragraph in the method section, it seemed as if the His tag is only on lptB. The paragraph related to figure 2 is about investigating the effect of His tag on lptB on the complex activity. Therefore, it is unlikely that the His tag was present on other proteins. It looks as if the figure legend was not accurate. Structural basis for lipopolysaccharide extraction by ABC transporter LptB2FG. Structural basis for lipopolysaccharide extraction by ABC transporter LptB2FG. Nature structural & molecular biology 2017 imex curation Luo Q., Yang X., Yu S., Shi H., Wang K., Xiao L., Zhu G., Sun C., Li T., Li D., Zhang X., Zhou M., Huang Y. yihuahuang@sun5.ibp.ac.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Luo Q., Yang X., Yu S., Shi H., Wang K., Xiao L., Zhu G., Sun C., Li T., Li D., Zhang X., Zhou M., Huang Y. From the first paragraph in the method section, it seemed as if the His tag is only on lptB. The paragraph related to figure 2 is about investigating the effect of His tag on lptB on the complex activity. Therefore, it is unlikely that the His tag was present on other proteins. It looks as if the figure legend was not accurate. yihuahuang@sun5.ibp.ac.cn Accepted 2019-APR-30 AT 10:08 BST AT 10:08 BST by ORCHARD Nature structural & molecular biology 2017 imex curation From the first paragraph in the method section, it seemed as if the His tag is only on lptB. The paragraph related to figure 2 is about investigating the effect of His tag on lptB on the complex activity. Therefore, it is unlikely that the His tag was present on other proteins. It looks as if the figure legend was not accurate. q9hvv6_pseae Lipopolysaccharide export system ATP-binding protein LptB PA4461 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MATLKAQHLAKSYKGRQVVRDVSMSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGVVRIDEQNVTHLPMHGRARAGIGYLPQEASIFRKLSVSDNIMAILETRSDLDRNGRKEALEGLLQEFHIHHIRDNLGMSLSGGERRRVEIARALASAPKFILLDEPFAGVDPISVGDIKQIIHHLKAKGIGILITDHNVRETLDICETAYIVNDGQLIAEGDAESILANDLVKEVYLGHEFRL A77C43C69317927A q9hvv8_pseae Lipopolysaccharide export system protein LptC lptC PA4459 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MPKTLRQKLLLALIALLLIVAGYYWNVGLELFNEQPTRPGQDNTIDYYAENAHSLQYQEDGSLDYEMTAVKLEHQKATDITFVTTPDLLLFRGNVQPWHIQSARAEVGPKGKEVELIDDVRVARTDAKGQPSILTTTRLTVFPDKNYAQTEQAVKIDAANGVTTAVGMKAYLKDSRMHLLSNVRGQHEVR 5CB84CE5F41A8AE3 q9hxh5_pseae PA3827 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MVKLDRYIGVTVFVAILAVLGVILGLALLFAFIDELNDISASYGIGDALRFIFLTAPRRAYDMLPMAALIGCLVGLGTLASNSELTIMRAAGVSLSRIVWAVMKPMLVLMLAGILVGEYVAPWTENIAQSGRALAQGGGDSQSSKRGLWHRQGREYIHINAVQPNGVLYGVTRYRFDEQRGLESASFAKRARFETDHWQLEEVTTTLLHPREKRSEVVKLPTERWDAQLSPQLLNTVVMEPEALSISGLWQYIHYLADQGLNNNRYWLAFWTKVLQPLVTAALVLMAISFIFGPLRSVTLGQRIFTGVLVGFVFRIAQDLLGPSSLVFDFPPLLAVVIPASICALAGVWLLRRAG 506E7090975080B5 q9hxh4_pseae Lipopolysaccharide export system permease protein LptF PA3828 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MIVFRYLSREVLVTMSAVSAVLLVIIMSGRFIKYLAQAAQGLLDPGSLFLIMAFRIPGFLQLILPLGLFLGILLAYGRLYLESEMTVLSATGMSQKRLLGYTMAPALLVAILVAWLSLFLAPQGINQFALLLNKQDTLTEFDTLVPGRFQAMRDGTRVTYTEELSKDRGELAGIFISQKDLNSSNQERGISILVAEKGTQNIQADGSRYLILHNGYRYDGNPGQANYRAIQYDTYGVMLPKPEASSEVSERDAVPTADLFGSDNPRYQAELQWRLSTPLLVFVVTLLAVPLSRVNPRQGRFLKLLPAILLYMGYLALLIAVRGQLDKGKIPMAIGLWWVHGLFLAIGLLLFYWEPLRLKLASSRAGREVAHG 38708A52C695846C q9hvv6_pseae-q9hxh4_pseae-1 1 5 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 structure determination identification by structure determination identification by structure determination structure determination predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association FIgure 1, Table 1 q9hvv6_pseae-q9hxh4_pseae-2 2 4 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) association association Figure 2 q9hvv6_pseae-lptc-1 2 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) association association Figure 2 q9hvv6_pseae-q9hxh4_pseae-3 2 5 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9HVV6:p.Glu163Gln E163Q mutation mutation certain certain sequence position certain certain certain sequence position certain E Q Tue Jun 30 16:25:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu163Gln' ecoli Escherichia coli (strain K12) association association Figure 2