UniProt UniProt http://www.uniprot.org Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Nucleophosmin Interacts with PIN2/TERF1-interacting Telomerase Inhibitor 1 (PinX1) and Attenuates the PinX1 Inhibition on Telomerase Activity. Scientific reports 2017 imex curation Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC., Cheung DH., Ho ST., Lau KF., Jin R., Wang YN., Kung HF., Huang JJ., Shaw PC. Source of PinX1 and NPM inferred from sequence length pcshaw@cuhk.edu.hk Accepted 2020-MAR-06 AT 08:47 GMT AT 08:47 GMT by LIVIAP Scientific reports 2017 Only protein-protein interactions imex curation imex curation pinx1_human PIN2/TERF1-interacting telomerase inhibitor 1 TRF1-interacting protein 1 Liver-related putative tumor suppressor Protein 67-11-3 PINX1 LPTS Pin2-interacting protein X1 LPTL protein protein human Homo sapiens Human MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK A298B31AEA6D18E1 npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 tert_human Telomerase reverse transcriptase TERT EST2 TCS1 TRT Telomerase catalytic subunit HEST2 Telomerase-associated protein 2 protein protein human Homo sapiens Human MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD DIP protein O14746 original sequence version: 129 DIP protein O14746 original sequence version: 95 DIP protein O14746 original sequence version: 125 DIP protein O14746 original sequence version: 121 DIP protein O14746-1 original sequence version: 110 94E35469C4CA33A0 npm1-pinx1-1 2 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1B pinx1-npm1-1 6 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1A, 3A, 3B pinx1-npm1-2 5 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C Consistently, FLAG-NPM was detected in the myc-PinX1 immunoprecipitate but not in the empty myc-vector control immunoprecipitate (Fig. 1c) pinx1-npm1-3 4 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 1D tert-npm1-1 2 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2A pinx1-npm1-4 2 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2B pinx1-npm1-5 3 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2D pinx1-npm1-6 3 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 2C tert-npm1-2 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2E pinx1-npm1-7 6 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3C, 3D pinx1-npm1-8 3 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P06748:p.Asp55Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 19:37:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp55Ala' n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P06748:p.Lys54Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:49:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys54Ala' P06748:p.Glu56Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 15:54:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu56Ala' P06748:p.Glu61Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 15:34:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu61Ala' P06748:p.Glu63Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 15:59:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu63Ala' P06748:p.Lys73Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:57:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys73Ala' P06748:p.Lys54_Asp55delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KD AA Wed Sep 18 12:56:15 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys54Ala;Asp55Ala]' Tue Jun 30 18:34:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys54_Asp55delinsAlaAla' P06748:p.Asp55_Glu56delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain DE AA Wed Sep 18 12:31:06 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp55Ala;Glu56Ala]' Tue Jun 30 16:41:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp55_Glu56delinsAlaAla' P06748:p.[Lys54Ala;Glu56Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys54Ala;Glu56Ala]' P06748:p.[Glu61Ala;Glu63Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 16:56:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu61Ala;Glu63Ala]' P06748:p.[Lys54Ala;Glu61Ala;Glu63Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:10:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys54Ala;Glu61Ala;Glu63Ala]' P06748:p.[Asp55Ala;Glu61Ala;Glu63Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 17:45:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp55Ala;Glu61Ala;Glu63Ala]' P06748:p.[Glu56Ala;Glu61Ala;Glu63Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 20:01:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu56Ala;Glu61Ala;Glu63Ala]' 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3E Consistently, FLAG-NPM was detected in the myc-PinX1 immunoprecipitate but not in the empty myc-vector control immunoprecipitate (Fig. 1c) pinx1-npm1-9 6 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified P06748:p.[Glu56Ala;Glu61Ala;Glu63Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Wed Sep 18 13:48:11 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'Glu56Ala;Glu61Ala;Glu63Alamutm' Tue Jun 30 16:55:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu56Ala;Glu61Ala;Glu63Ala]' ecoli Escherichia coli (strain K12) 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3F tert-npm1-3 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range RNA-binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4A, 4B pinx1-tert-2 3 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4C, 4D The amount of hTERT that interacted with PinX1 was slightly increased by NPM overexpression, but it was not affected by down-regulation of NPM npm1-tert-1 3 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P06748:p.[Glu56Ala;Glu61Ala;Glu63Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 18:24:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu56Ala;Glu61Ala;Glu63Ala]' physical association physical association Fig. 4E, 4F, Supp Fig 2B, 2C The down-regulation of PinX1 reduced the association of TERT with NPM while overexpression of PinX1 enhanced the TERT association to NPM I don't think the effect of PINX1 is enough to qualify for 'Ancillary' so have only added as a comment pinx1-npm1-10 1 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association