IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Contribution of LHX4 Mutations to Pituitary Deficits in a Cohort of 417 Unrelated Patients. Contribution of LHX4 Mutations to Pituitary Deficits in a Cohort of 417 Unrelated Patients. The Journal of clinical endocrinology and metabolism 2017 imex curation Cohen E., Maghnie M., Collot N., Leger J., Dastot F., Polak M., Rose S., Touraine P., Duquesnoy P., Tauber M., Copin B., Bertrand AM., Brioude F., Larizza D., Edouard T., González Briceño L., Netchine I., Oliver-Petit I., Sobrier ML., Amselem S., Legendre M. Rare diseases - Interactions investigated in the context of Rare genetic disease marie.legendre@aphp.fr. 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cohen E., Maghnie M., Collot N., Leger J., Dastot F., Polak M., Rose S., Touraine P., Duquesnoy P., Tauber M., Copin B., Bertrand AM., Brioude F., Larizza D., Edouard T., González Briceño L., Netchine I., Oliver-Petit I., Sobrier ML., Amselem S., Legendre M. Rare diseases - Interactions investigated in the context of Rare genetic disease marie.legendre@aphp.fr. Accepted 2019-JUL-15 AT 13:25 BST AT 13:25 BST by PPORRAS The Journal of clinical endocrinology and metabolism 2017 Only protein-protein interactions imex curation imex curation isl2_human Insulin gene enhancer protein ISL-2 ISL2 protein protein human Homo sapiens Human MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET lhx4_human LIM/homeobox protein Lhx4 LHX4 protein protein human Homo sapiens Human MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF 6499F38E78B79FD1 6499F38E78B79FD1 lhx3_human LIM/homeobox protein Lhx3 LHX3 protein protein human Homo sapiens Human MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF FB4A2E48C015C249 isl2-lhx4-1 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q969G2:p.Ala65Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 18:16:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala65Val' p.Gln29_Asp80del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain QCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKED . Q969G2:p.[Cys57Ala;Cys60Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:07:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys57Ala;Cys60Ala]' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 5e isl2-lhx4-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q969G2:p.Ala65Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 17:54:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala65Val' p.Gln29_Asp80del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain QCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKED . Q969G2:p.[Cys57Ala;Cys60Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:43:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys57Ala;Cys60Ala]' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 5f