IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutations in CRADD Result in Reduced Caspase-2-Mediated Neuronal Apoptosis and Cause Megalencephaly with a Rare Lissencephaly Variant. Mutations in CRADD Result in Reduced Caspase-2-Mediated Neuronal Apoptosis and Cause Megalencephaly with a Rare Lissencephaly Variant. American journal of human genetics 2016 imex curation Di Donato N., Jean YY., Maga AM., Krewson BD., Shupp AB., Avrutsky MI., Roy A., Collins S., Olds C., Willert RA., Czaja AM., Johnson R., Stover JA., Gottlieb S., Bartholdi D., Rauch A., Goldstein A., Boyd-Kyle V., Aldinger KA., Mirzaa GM., Nissen A., Brigatti KW., Puffenberger EG., Millen KJ., Strauss KA., Dobyns WB., Troy CM., Jinks RN. Rare diseases - Interactions investigated in the context of Rare genetic disease nataliya.didonato@uniklinikum-dresden.de, rjinks@fandm.edu 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Di Donato N., Jean YY., Maga AM., Krewson BD., Shupp AB., Avrutsky MI., Roy A., Collins S., Olds C., Willert RA., Czaja AM., Johnson R., Stover JA., Gottlieb S., Bartholdi D., Rauch A., Goldstein A., Boyd-Kyle V., Aldinger KA., Mirzaa GM., Nissen A., Brigatti KW., Puffenberger EG., Millen KJ., Strauss KA., Dobyns WB., Troy CM., Jinks RN. Rare diseases - Interactions investigated in the context of Rare genetic disease nataliya.didonato@uniklinikum-dresden.de, rjinks@fandm.edu Accepted 2019-SEP-30 AT 10:11 BST AT 10:11 BST by PPORRAS American journal of human genetics 2016 Only protein-protein interactions imex curation imex curation Mutations in CRADD Result in Reduced Caspase-2-Mediated Neuronal Apoptosis and Cause Megalencephaly with a Rare Lissencephaly Variant. Mutations in CRADD Result in Reduced Caspase-2-Mediated Neuronal Apoptosis and Cause Megalencephaly with a Rare Lissencephaly Variant. American journal of human genetics 2016 imex curation Di Donato N., Jean YY., Maga AM., Krewson BD., Shupp AB., Avrutsky MI., Roy A., Collins S., Olds C., Willert RA., Czaja AM., Johnson R., Stover JA., Gottlieb S., Bartholdi D., Rauch A., Goldstein A., Boyd-Kyle V., Aldinger KA., Mirzaa GM., Nissen A., Brigatti KW., Puffenberger EG., Millen KJ., Strauss KA., Dobyns WB., Troy CM., Jinks RN. Rare diseases - Interactions investigated in the context of Rare genetic disease nataliya.didonato@uniklinikum-dresden.de, rjinks@fandm.edu 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Di Donato N., Jean YY., Maga AM., Krewson BD., Shupp AB., Avrutsky MI., Roy A., Collins S., Olds C., Willert RA., Czaja AM., Johnson R., Stover JA., Gottlieb S., Bartholdi D., Rauch A., Goldstein A., Boyd-Kyle V., Aldinger KA., Mirzaa GM., Nissen A., Brigatti KW., Puffenberger EG., Millen KJ., Strauss KA., Dobyns WB., Troy CM., Jinks RN. Rare diseases - Interactions investigated in the context of Rare genetic disease nataliya.didonato@uniklinikum-dresden.de, rjinks@fandm.edu Accepted 2019-SEP-30 AT 10:11 BST AT 10:11 BST by PPORRAS American journal of human genetics 2016 Only protein-protein interactions imex curation imex curation pidd1_human p53-induced death domain-containing protein 1 PIDD1 LRDD Leucine-rich repeat and death domain-containing protein PIDD protein protein human Homo sapiens Human MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA 8C98FC64230B57F8 casp2_rat Caspase-2 Casp2 Ich1 Protease ICH-1 protein protein rat Rattus norvegicus (Rat) Rat MAASSGRSQSSLHRKGLMAADRRSRILAVCGMHPDHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKGGSFSQNVELLNLLPKRGPQAFDAFCEALRETRQGHLEDLLLTTLSDIQHILPPLSCDYDSSLPFSVCESCPPHKQSRLSTDTMEHSLDNGDGPPCLQVKPCTPEFYQAHYQLAYRLQSQPRGLALVMSNVHFTGEKDLEFRSGGDVDHTTLVTLFKLLGYNVHVLYDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAQSPGCEESDAGKEELMKMRLPTRSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGYAPGTEFHRCKEMSEYCSTLCQQLYLFPGYPPT DIP protein P55215 original sequence version: 93 cradd_human Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain CRADD RAIDD protein protein human Homo sapiens Human MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE 3437CC612C85E402 cradd-pidd1-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P78560:p.Gly128Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 16:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly128Arg' P78560:p.Arg170Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:47:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg170Cys' P78560:p.Arg170His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:25:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg170His' P78560:p.Phe164Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F C Tue Jun 30 17:48:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe164Cys' physical association physical association Figure 2d antp-casp2-1 2 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey prot passive uptake protein passive uptake prot passive uptake P78560:p.Gly128Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 19:34:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly128Arg' P78560:p.Arg170Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 18:09:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg170Cys' P78560:p.Arg170His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:48:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg170His' region penetrating tag penetrating tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78560:p.Phe164Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F C Tue Jun 30 17:52:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe164Cys' association association Figure 2e