UniProt UniProt http://www.uniprot.org The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. ACS chemical biology 2014 imex curation Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. tsss@fct.unl.pt,sleim@uni-potsdam.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. tsss@fct.unl.pt,sleim@uni-potsdam.de Accepted 2020-JAN-30 AT 15:20 GMT AT 15:20 GMT by MGT ACS chemical biology 2014 Only protein-protein interactions imex curation imex curation The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. ACS chemical biology 2014 imex curation Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. tsss@fct.unl.pt,sleim@uni-potsdam.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) biophysical biophysical predetermined predetermined participant predetermined Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. X-Ray Absorption Spectroscopy tsss@fct.unl.pt,sleim@uni-potsdam.de Accepted 2020-JAN-30 AT 15:20 GMT AT 15:20 GMT by MGT ACS chemical biology 2014 Only protein-protein interactions imex curation imex curation The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. The Escherichia coli Periplasmic Aldehyde Oxidoreductase Is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes. ACS chemical biology 2014 imex curation Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. tsss@fct.unl.pt,sleim@uni-potsdam.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Otrelo-Cardoso AR., da Silva Correia MA., Schwuchow V., Svergun DI., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T., Correia MA., Otrelo-Cardoso AR., Schwuchow V., Sigfridsson Clauss KG., Haumann M., Romão MJ., Leimkühler S., Santos-Silva T. Not sure what to do about the missing name, so have ignored and hope EPMC will eventually sort itself out. tsss@fct.unl.pt,sleim@uni-potsdam.de Accepted 2020-JAN-30 AT 15:20 GMT AT 15:20 GMT by MGT ACS chemical biology 2014 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method mo(vi)-molybdopterin cytosine dinucleotide(2-) Mo(VI)-molybdopterin cytosine dinucleotide(2-) Mo-molybdopterin cytosine dinucleotide MoO2-molybdopterin cytosine dinucleotide(2-) {5'-O-[{[{[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]cytidinato(4-)}(dioxo)molybdate(2-) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tetra-mu3-sulfido-tetrairon tetra-mu(3)-sulfido-tetrairon (IRON/SULFUR CLUSTER) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) paoc_ecoli Aldehyde oxidoreductase molybdenum-binding subunit PaoC paoC yagR JW0278 b0284 protein protein ecoli Escherichia coli (strain K12) MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEEAPNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPTIEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVNQPPEDTPDKNVGDFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAKTLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTHRPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLATLDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRRQLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGTVTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTSGVYAACMKLREMIASAVGFDPEQSQFADGKITNGTRSATLHEATAGGRLTAEESIEFGTLSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMGAALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELGLCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV AF198715794F0138 benzaldehyde benzaldehyde Artificial almond oil Benzaldehyde benzaldehyde Benzanoaldehyde Benzene carbaldehyde Benzene carboxaldehyde Benzenecarbonal Benzenecarboxaldehyde Benzenemethylal Benzoic acid aldehyde Benzoic aldehyde Benzylaldehyde Ethereal oil of bitter almonds Phenylformaldehyde Phenylmethanal Synthetic oil of bitter almond benzaldehyde small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fad(3-) FAD(3-) FAD FAD trianion small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) IMGVNJNCCGXBHD-UYBVJOGSSA-K IMGVNJNCCGXBHD-UYBVJOGSSA-K fe2s2 iron-sulfur cluster Fe2S2 iron-sulfur cluster 2 iron, 2 sulfur cluster [2Fe-2S] cluster small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) paob_ecoli Aldehyde oxidoreductase FAD-binding subunit PaoB paoB yagS JW0279 b0285 protein protein ecoli Escherichia coli (strain K12) MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPLGGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQAVYDTLFASAHPTAENTFKLLLAKRTLASVLAEARAQA 7D51C2B30C9BB222 paoa_ecoli Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA paoA yagT JW0280 b0286 protein protein ecoli Escherichia coli (strain K12) MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHSTLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS 216961D7BD21836C paoa-paob-1 3 7 unspecified role unspecified role neutral component neutral component purified purified 11 unspecified role unspecified role neutral component neutral component purified purified 12 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 2 paoa-paob-2 2 7 unspecified role unspecified role neutral component neutral component purified purified 11 unspecified role unspecified role neutral component neutral component purified purified 12 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2 Cyanide treatment of the complex to remove the equatorial sulfido ligand made no difference to the spectra paoa-paob-3 3 7 unspecified role unspecified role neutral component neutral component purified purified P77489:p.Arg440Cys mutation mutation certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 16:26:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg440Cys' 11 unspecified role unspecified role neutral component neutral component purified purified 12 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 2 benzaldehyde-paoabc_ecoli-1 1 31 enzyme enzyme unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role redox reaction oxidoreductase activity electron transfer reaction redox reaction Fig. 7 The PaoC-R440H variant showed a slightly increased Km and a slightly lower kcat in comparison to the wild-type. The Km values of the PaoC-R440 K variant were twice as high in comparison to the wild-type, while the kcat for this variant was about 3-times reduced. pH optimum for the catalytic efficiency is at pH 4.0 for the wild- type and the PaoC-R440H variant and at pH 4.5 for the PaoC- R440 K variant. paoabc_ecoli PaoABC periplasmic aldehyde oxidoreductase paoA:paoB:paoC yagTSR complex 10 cofactor cofactor coenzyme paoa binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 cofactor cofactor coenzyme paoa binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 cofactor cofactor coenzyme paoc binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 cofactor cofactor coenzyme paob binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 cofactor cofactor coenzyme paob binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 enzyme enzyme molybdopterin cytosine dinucleotide binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain paoa binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined paob binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 enzyme enzyme fad binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 4fe-4s binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain paoa binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined paoc binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 enzyme enzyme paob binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined fe2s2 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain fe2s2 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain paoc binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 55 34 36 54 44 38 40 49 42 48 56 45 51 46 50 53 physical association physical association ecoli Escherichia coli (strain K12) stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A periplasmic aldehyde oxidoreductase that oxidises aldehydes to the corresponding carboxylic acids. Preferentially detoxifies aromatic aldehydes, excluding purines. At high doses, aromatic aldehydes can act as antimicrobial agents. The 135 kDa enzyme complex creates a set of redox centers involved in electron transfer and contains a transition metal molybdenum as a biologically active cofactor. Heterotrimer Accepted 2020-JAN-13 by LIVIAP