IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle. New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle. International journal of molecular sciences 2016 imex curation Evans AE., Tripathi A., LaPorte HM., Brueggemann LI., Singh AK., Albee LJ., Byron KL., Tarasova NI., Volkman BF., Cho TY., Gaponenko V., Majetschak M. I have added the CXCR4 TM2 and TM4 peptides as "sufficient to Bind" regions with C terminal Aspartate addtions, rather than adding as newly created peptides. All HGVS examples include a "stop" codon, which is hardly the case here, so I have entered the extension as in IntAct document "previous case" as a "delins". If you think these should be re-done as internal peptides let me know, but I thought it preferable to use "sufficient to bind".?? mmajetschak@luc.edu email address will change early 2019 to:- mmajetschak@gmail.com or to majetschak@health.usf.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Evans AE., Tripathi A., LaPorte HM., Brueggemann LI., Singh AK., Albee LJ., Byron KL., Tarasova NI., Volkman BF., Cho TY., Gaponenko V., Majetschak M. I have added the CXCR4 TM2 and TM4 peptides as "sufficient to Bind" regions with C terminal Aspartate addtions, rather than adding as newly created peptides. All HGVS examples include a "stop" codon, which is hardly the case here, so I have entered the extension as in IntAct document "previous case" as a "delins". If you think these should be re-done as internal peptides let me know, but I thought it preferable to use "sufficient to bind".?? Human aortic vascular smooth muscle cells (hVSMC). mmajetschak@luc.edu email address will change early 2019 to:- mmajetschak@gmail.com or to majetschak@health.usf.edu Accepted 2019-APR-03 AT 14:49 BST AT 14:49 BST by LIVIAP International journal of molecular sciences 2016 Only protein-protein interactions imex curation imex curation New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle. New Insights into Mechanisms and Functions of Chemokine (C-X-C Motif) Receptor 4 Heteromerization in Vascular Smooth Muscle. International journal of molecular sciences 2016 imex curation Evans AE., Tripathi A., LaPorte HM., Brueggemann LI., Singh AK., Albee LJ., Byron KL., Tarasova NI., Volkman BF., Cho TY., Gaponenko V., Majetschak M. I have added the CXCR4 TM2 and TM4 peptides as "sufficient to Bind" regions with C terminal Aspartate addtions, rather than adding as newly created peptides. All HGVS examples include a "stop" codon, which is hardly the case here, so I have entered the extension as in IntAct document "previous case" as a "delins". If you think these should be re-done as internal peptides let me know, but I thought it preferable to use "sufficient to bind".?? mmajetschak@luc.edu email address will change early 2019 to:- mmajetschak@gmail.com or to majetschak@health.usf.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-smooth muscle mouse smooth muscle smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Evans AE., Tripathi A., LaPorte HM., Brueggemann LI., Singh AK., Albee LJ., Byron KL., Tarasova NI., Volkman BF., Cho TY., Gaponenko V., Majetschak M. I have added the CXCR4 TM2 and TM4 peptides as "sufficient to Bind" regions with C terminal Aspartate addtions, rather than adding as newly created peptides. All HGVS examples include a "stop" codon, which is hardly the case here, so I have entered the extension as in IntAct document "previous case" as a "delins". If you think these should be re-done as internal peptides let me know, but I thought it preferable to use "sufficient to bind".?? Aortic smooth muscle cells from transgenic mice carrying the CreERT2 transgene and homozygous for the CXCR4 loxP allele, resulting in CXCR4 knockdown following tamoxifen injection. mmajetschak@luc.edu email address will change early 2019 to:- mmajetschak@gmail.com or to majetschak@health.usf.edu Accepted 2019-APR-03 AT 14:49 BST AT 14:49 BST by LIVIAP International journal of molecular sciences 2016 Only protein-protein interactions imex curation imex curation ada1b_mouse Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor Adra1b protein protein mouse Mus musculus Mouse MNPDLDTGHNTSAPAHWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGCLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTDLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLPSASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESPGTEGDASNGGCDTTTDLANGQPGFKSNMPLAPGHF 17CFD10123DC2B29 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK A863EC1AFB5B158B ackr3_mouse Atypical chemokine receptor 3 C-X-C chemokine receptor type 7 Chemokine orphan receptor 1 G-protein coupled receptor RDC1 homolog Ackr3 Cmkor1 Cxcr7 Rdc1 protein protein mouse Mus musculus Mouse MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK 7A0399DED5B73E66 ada1a_mouse Alpha-1A adrenergic receptor Adra1a Adra1c Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor protein protein mouse Mus musculus Mouse MVLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTLHPPSQAVEGQHRGMVRIPVGSGETFYKISKTDGVREWKFFSSMPQGSARITMPKDQSACTTARVRSKSFLQVCCCVGSSTPRPEENHQVPTIKIHTISLGENGEEV 8C5FE5C67E885795 ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV DIP protein P35348 original sequence version: 126 1A50487531DECDF0 cxcr4_mouse C-X-C chemokine receptor type 4 Cxcr4 Cmkar4 Lestr Sdf1r Fusin Leukocyte-derived seven transmembrane domain receptor Pre-B-cell-derived chemokine receptor Stromal cell-derived factor 1 receptor protein protein mouse Mus musculus Mouse MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVSQGDISQGDDRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQGCDFESIVHKWISITEALAFFHCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS 33D1B5552A31595B ackr3-cxcr4-5 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1A-1 adra1a-cxcr4-12 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1A-2 adra1a-cxcr4-13 1 4 competitor competitor competitor neutral component neutral component purified purified p.Asn106delinsAsnAspAsp TM2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain LLFVITLPFWAVDAVANWYFGN LLFVITLPFWAVDAVANWYFGNDD chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1A/B a TM2 peptide analog reduced the PLA signals corresponding to CXCR4:a1A-AR complexes, but did not affect PLA signals for CXCR4:ACKR3 interactions (Figure 1B) a TM2 peptide analog reduced the PLA signals corresponding to CXCR4:a1A-AR complexes, but did not affect PLA signals for the CXCR4:ACKR3 interaction. ackr3-cxcr4-6 1 4 competitor competitor competitor neutral component neutral component purified purified p.Asn176delinsAsnAspAsp TM4_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain VYVGVWIPALLLTIPDFIFAN VYVGVWIPALLLTIPDFIFANDD chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1A/C incubation of hVSMC with a TM4 peptide analog did not affect PLA signals for CXCR4:α1A-AR complexes, whereas PLA signals for CXCR4:ACKR3 complexes were significantly reduced (Figure 1C). The presence of TM4 peptide reduced signals for signals for CXCR4:ACKR3 complexes. ackr3-cxcr4-7 2 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 B/D Signals for CXCR4:a1A/B-AR and CXCR4:ACKR3 interactions were not altered after tamoxifen injection. signals for CXCR4:a1A/B-AR and CXCR4:ACKR3 interactions were not altered after tamoxifen injection ackr3-cxcr4-8 2 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 B/D Signals for CXCR4:a1A/B-AR and CXCR4:ACKR3 interactions were not altered after tamoxifen injection. adra1a-cxcr4-14 2 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 4 B/D Signals for CXCR4:a1A/B-AR and CXCR4:ACKR3 interactions were not altered after tamoxifen injection.