IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ UBA5 Mutations Cause a New Form of Autosomal Recessive Cerebellar Ataxia. UBA5 Mutations Cause a New Form of Autosomal Recessive Cerebellar Ataxia. PloS one 2015 imex curation Duan R., Shi Y., Yu L., Zhang G., Li J., Lin Y., Guo J., Wang J., Shen L., Jiang H., Wang G., Tang B. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. duanranhui@sklmg.edu.cn,bstang7398@163.com 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293a Homo sapiens hek293a hek293a anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Duan R., Shi Y., Yu L., Zhang G., Li J., Lin Y., Guo J., Wang J., Shen L., Jiang H., Wang G., Tang B. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. duanranhui@sklmg.edu.cn,bstang7398@163.com Accepted 2019-NOV-01 AT 14:03 GMT AT 14:03 GMT by LIVIAP PloS one 2015 Only protein-protein interactions imex curation imex curation ufm1_human Ubiquitin-fold modifier 1 UFM1 C13orf20 BM-002 protein protein human Homo sapiens Human MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC EDB2412E5E5836D8 uba5_human Ubiquitin-like modifier-activating enzyme 5 Ubiquitin-activating enzyme E1 domain-containing protein 1 UFM1-activating enzyme ThiFP1 UBA5 UBE1DC1 protein protein human Homo sapiens Human MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM 02F0F64FEAA1E880 uba5-ufm1-1 1 2 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9GZZ9:p.Lys310Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 17:52:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys310Glu' region NP_938143.1:p.Arg190* required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain EGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM physical association physical association Figure 2e