IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? Cross-linker:dithiobis(succinimidyl propionate) (DSP). After Crosslinking proteins were precipitated from lysates using anti-Myc and anti-sorLA antibodies. jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. The Expression system for CLF1 is unclear; the text under figure 1 states "we used a His-tagged CLF-1 construct purified from the medium of stably transfected CHO cells (Fig. 1B)" whereas the Methods section (cDNA constructs etc..) states CLF1 was expressed in human-293 cells. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? SorLA propeptide has been assumed to be aas 29-81 (pro_0000033164) from Uniprot, although these numbers are not given in this publication nor Ref.26; however the propeptide is referred to as having 53 residues -the length of pro_0000033164. jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor α Signaling and sorLA-Mediated Turnover. Molecular and cellular biology 2016 imex curation Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? publication was "tagged" by Imex Central for DSP; but i cannot find it on Pablo's list. Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. (and all the unanswered emails) jvl@biomed.au.dk,cmp@biomed.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM., Larsen JV., Kristensen AM., Pallesen LT., Bauer J., Vægter CB., Nielsen MS., Madsen P., Petersen CM. email sent to authors 6/1/2020; 1] You use "his-tagged CLF1" in figure 1B/E,2B,and 3A. According to the Methods section (cDNA constructs etc..) this construct was expressed and purified from Human-293 cells, but under Figure 1 it is stated to be purified from .. :- "stably transfected CHO cells" So for which was the expression system? 2] Regarding the exact sequences of various SorLA constructs as used in SPR:- A) In Figure 1, and elsewhere, you use the "immobilized luminal domain of sorLA" or "ectodomain" of SorLA or "immobilized soluble sorLA, i.e., the luminal part of full-length sorLA". According to reference 26 this may be SorLA "Soluble sorLA-(54–2107)" Please can you confirm if this was the correct sequence used? B) Can you confirm that the sequence of the PROPEPTIDE is aas 29-81? C) In Figure 6A you use "the immobilized luminal (entire extracellular) part of sorLA." Is this the same construct as in Figure 1 (54-2107) or a different construct? - if different, what was the sequence numbering? jvl@biomed.au.dk,cmp@biomed.au.dk Accepted 2020-FEB-03 AT 11:02 GMT AT 11:02 GMT by ORCHARD Molecular and cellular biology 2016 Only protein-protein interactions imex curation imex curation sorl_human Sortilin-related receptor Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SORL1 C11orf32 protein protein human Homo sapiens Human MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein Q92673 original sequence version: 154 4C215BB33E65C0B2 amrp_human Alpha-2-macroglobulin receptor-associated protein Low density lipoprotein receptor-related protein-associated protein 1 LRPAP1 A2MRAP protein protein human Homo sapiens Human MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL DIP protein P30533 original sequence version: 105 DIP protein P30533 original sequence version: 103 D56A7DA754125CFA crlf1_human Cytokine receptor-like factor 1 CRLF1 Cytokine-like factor 1 ZcytoR5 UNQ288/PRO327 protein protein human Homo sapiens Human MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR DIP protein O75462 original sequence version: 131 sorl_mouse Sortilin-related receptor Sorl1 Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats Gp250 protein protein mouse Mus musculus Mouse MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQDRGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFSKISEKLNFGVGNNSEAVISQFYHSPADNKRYIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQFVTKHPINEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVFSEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAMRKSIYRYDLASGATEQLPLSGLRAAVALDFDYERNCLYWSDLALDTIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDVKWPNGISVDSQWIYWTDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKHSRSQVEILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVASSVLPSGDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQDGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCEPFCTRFMDFVCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHVLPSPTPGPSTCLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFKCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNTNDFVTLRTPEGLPDAPRNLQLSLNSEEEGVILGHWAPPVHTHGLIREYIVEYSRSGSKMWASQRAASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQAPNIHIDSYDENSLSFTLTMDGDIKVNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHRVSNLTAHTSYEISAWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNVVYGIFYATSFLDLYRNPKSVTTSLHNKTVIVSKDEQYLFLVRVLIPYQGPSSDYVVVKMIPDSRLPPRHLHAVHIGKTSALIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVRSRNSTVEYSLSKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKQFNETRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICGEPAVLLYDELSSGADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFSAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein O88307 original sequence version: 73 mint Likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. Binds the receptor-associated protein (RAP). Could play a role in cell-cell interaction. May play a role in neural organization, as well as the establishment of embryonic organ systems 5D7F53806EFE2CB0 cntfr_human Ciliary neurotrophic factor receptor subunit alpha CNTFR protein protein human Homo sapiens Human MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLALAAAAATASSLLI B2F3F73DE8F8750E q9ubd9-pro_0000015616 Cardiotrophin-like cytokine factor 1 CLCF1 B-cell-stimulating factor 3 BSF3 CLC NNT1 Novel neurotrophin-1 protein protein human Homo sapiens Human LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF 28 225 clc_cntfra_fusion protein protein protein human Homo sapiens Human QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPGSGSSRGGSGSGGSGGGGSKLLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF q92673-pro_0000033164 Removed in mature form SORL1 C11orf32 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SorLA-1 Sorting protein-related receptor containing LDLR class A repeats protein protein human Homo sapiens Human EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKR 29 81 o75462-pro_0000011039 Cytokine receptor-like factor 1 CRLF1 Cytokine-like factor 1 ZcytoR5 UNQ288/PRO327 protein protein human Homo sapiens Human AHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR 38 422 sort1-pro_0000011039-1 4 11 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 12 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role prey prey purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 21 23 physical association physical association 1A cntfr-pro_0000011039-1 4 11 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 12 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B-1 cntfr-crlf1-1 4 11 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 9 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain undetermined undetermined sequence position undetermined direct interaction direct interaction 1B-2 The Expression system for CLF1 is unclear; the text under figure 1 states "we used a His-tagged CLF-1 construct purified from the medium of stably transfected CHO cells (Fig. 1B)" whereas the Methods section (cDNA constructs etc..) states CLF1 was expressed in human-293 cells. cntfr-pro_0000011039-2 4 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 12 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role prey prey purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 42 40 physical association physical association 1C it is not clear what "soluble-SORLA" is - so have entered my best-guess from ref.26. sorl1-q92673_pro_0000033164-1 4 14 unspecified role unspecified role prey prey purified purified crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 1D/F Binding of CLC:CLF-1 (or CLF-1 alone) to SORLA was completely abolished in the presence of a surplus of sorLA's own propeptide. cntfr-crlf1-2 4 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 9 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction 1E, 2B The Expression system for CLF1 is unclear; the text under figure 1 states "we used a His-tagged CLF-1 construct purified from the medium of stably transfected CHO cells (Fig. 1B)" whereas the Methods section (cDNA constructs etc..) states CLF1 was expressed in human-293 cells. sorl1-crlf1-1 4 13 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 9 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 58 60 physical association physical association 2B Binding of the fusion protein to preformed CLF-1:sorLA complex was observed. sorl1-pro_0000011039-1 6 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 ancillary ancillary neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 66 68 colocalization colocalization 3B pro_0000011039-pro_0000015616-1 6 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 12 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 74 76 colocalization colocalization 3C An anti-His antibody was used to detect binding of CLF-1/CLC Complex;so either, or both, molecules were detected. not sure if this should be included - as probably binding is only to CLF-1- but not shown experimentally here. cntfr-pro_0000011039-3 6 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-astrocyte Mus musculus astrocyte [Brain astrocytes; Astroglia] astrocyte Astrocytes [Brain astrocytes; Astroglia] 12 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 15 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 82 84 colocalization colocalization 4A An anti-His antibody was used to detect binding of CLF-1/CLC Complex;so either, or both, molecules were detected. pro_0000011039-pro_0000015616-2 6 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron 15 unspecified role unspecified role neutral component neutral component purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 12 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 93 89 colocalization colocalization 4B An anti-His antibody was used to detect binding of CLF-1/CLC Complex;so either, or both, molecules were detected. cntfr-sorl1-1 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 5B Exogenous CLC (Q9UBD9) Exogenous CLC:CLF-1 (Q9UBD9 + P26992) Staining was particularly strong in the cells treated with CLC:CLF-1, but minor staining was also seen upon stimulation with CLC and, surprisingly, in cells not subjected to either of the two ligands. sorl1-cntfr-1 4 7 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 11 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. direct interaction direct interaction 6 A/C Interaction between the luminal domains of CNTFRa and sorLA;Concentration-dependent binding of sCNTFRa to the immobilized luminal (entire extracellular) part of sorLA. Interaction between the luminal domains of CNTFRα and sorLA. it is unclear how the "entire extracellular" part of SorLA differs from that used before; authors asked -? any reply? sorl1-cntfr-2 4 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 6B It is stated that:- "Soluble CNTFRa bound to immobilized sorLA and competed with RAP for binding (Fig. 6A and B.) cntfr-sorl1-5 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range mature_protein sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 6D-1 cntfr-sorl1-2 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range mature_protein sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 6D-2 cntfr-sorl1-4 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range mature_protein sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 6D A weak band (SorLA) is seen in the absence of cross-linker and the presence of DTT. there is no mention of this in the text - but there IS a band cntfr-sorl1-3 5 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range mature_protein sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 6D A weak band (CNTFRa) is seen in the absence of cross-linker and the presence of DTT. there is no mention of this in the text - but there IS a band sorl1-lrpap1-1 4 11 competitor competitor competitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association 6B-2 It is stated that:- "Soluble CNTFRa bound to immobilized sorLA and competed with RAP for binding (Fig. 6A and B.) sorl1-pro_0000033164-5 4 9 competitor competitor competitor unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey purified purified crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 7 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 1D/F-2 Binding of CLC:CLF-1 (or CLF-1 alone) to SORLA was completely abolished in the presence of a surplus of sorLA's own propeptide. The Expression system for CLF1 is unclear; the text under figure 1 states "we used a His-tagged CLF-1 construct purified from the medium of stably transfected CHO cells (Fig. 1B)" whereas the Methods section (cDNA constructs etc..) states CLF1 was expressed in human-293 cells.