UniProt UniProt http://www.uniprot.org The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Human brain cDNA Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. Structure illumination microscopy unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. The novel RAGE interactor PRAK is associated with autophagy signaling in Alzheimer's disease pathogenesis. Molecular neurodegeneration 2016 imex curation Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. unihoi@snu.ac.kr 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kim Y., Kim C., Son SM., Song H., Hong HS., Han SH., Mook-Jung I. No indication of expression systems or level of purity given unihoi@snu.ac.kr Accepted 2019-AUG-28 AT 07:57 BST AT 07:57 BST by MGT Molecular neurodegeneration 2016 Only protein-protein interactions imex curation imex curation rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP DIP protein Q15109 original sequence version: 157 0D584C436C30CCE7 mapk5_human MAP kinase-activated protein kinase 5 MAPKAPK5 PRAK p38-regulated/activated protein kinase protein protein human Homo sapiens Human MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ F3D9DDC83CC0C49D mapk5_mouse MAP kinase-activated protein kinase 5 Mapkapk5 protein protein mouse Mus musculus Mouse MSEDSDMEKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALQHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKVDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRKKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDGIYIHDHENGTEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDALQSFSWNGRGFTDKVDRLKLAEVVKQVIEEQTLPHEPQ 45441A735075B247 ager-mapkapk5-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1A ager-mapkapk5-2 1 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1B ager-mapkapk5-3 7 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1C mapkapk5-ager-1 4 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction Fig. 2A APP, Amyloid-beta (Q8IW41) ager-mapkapk5-4 6 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization Fig. 2B APP, Amyloid-beta (Q8IW41) ager-mapkapk5-5 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2C The binding of Mapkapk5 to Ager was increased in the brains of Tg6799 mice, which express high levels of mutant APP and PSEN1, when compared to wild-type litter mates. ager-mapkapk5-6 5 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp Fig. 1