IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. The Journal of biological chemistry 2015 imex curation Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch Accepted 2019-AUG-15 AT 11:52 BST AT 11:52 BST by ORCHARD The Journal of biological chemistry 2015 Only protein-protein interactions imex curation imex curation IDM updated; exp-mod added; Missing data in 1a-c & 1f captured; MMACHC homodimer not captured as the monomers were not provided with different tags Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. The Journal of biological chemistry 2015 imex curation Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes weight identificat confirmation by molecular weight weight identificat Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch Accepted 2019-AUG-15 AT 11:52 BST AT 11:52 BST by ORCHARD The Journal of biological chemistry 2015 Only protein-protein interactions imex curation imex curation IDM updated; exp-mod added; Missing data in 1a-c & 1f captured; MMACHC homodimer not captured as the monomers were not provided with different tags Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. The Journal of biological chemistry 2015 imex curation Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease MMACHC-MMADHC complex was initially purified by affinity chromotography matthias.baumgartner@kispi.uzh.ch Accepted 2019-AUG-15 AT 11:52 BST AT 11:52 BST by ORCHARD The Journal of biological chemistry 2015 Only protein-protein interactions imex curation imex curation IDM updated; exp-mod added; Missing data in 1a-c & 1f captured; MMACHC homodimer not captured as the monomers were not provided with different tags Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. Structural Insights into the MMACHC-MMADHC Protein Complex Involved in Vitamin B12 Trafficking. The Journal of biological chemistry 2015 imex curation Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Froese DS., Kopec J., Fitzpatrick F., Schuller M., McCorvie TJ., Chalk R., Plessl T., Fettelschoss V., Fowler B., Baumgartner MR., Yue WW. Rare diseases - Interactions investigated in the context of Rare genetic disease matthias.baumgartner@kispi.uzh.ch Accepted 2019-AUG-15 AT 11:52 BST AT 11:52 BST by ORCHARD The Journal of biological chemistry 2015 Only protein-protein interactions imex curation imex curation IDM updated; exp-mod added; Missing data in 1a-c & 1f captured; MMACHC homodimer not captured as the monomers were not provided with different tags mmac_human Cyanocobalamin reductase / alkylcobalamin dealkylase MMACHC CblC Cyanocobalamin reductase (cyanide-eliminating) Alkylcobalamin:glutathione S-alkyltransferase Methylmalonic aciduria and homocystinuria type C protein protein protein human Homo sapiens Human MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP 3A7E6BC774CB5D17 mmad_human Cobalamin trafficking protein CblD Methylmalonic aciduria and homocystinuria type D protein, mitochondrial HSPC161 My011 MMADHC C2orf25 CL25022 CblD protein protein human Homo sapiens Human MANVLCNRARLVSYLPGFCSLVKRVVNPKAFSTAGSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHLNGTASQKKSLVHKTLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETYFESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEVEIEREVLLEKFINGAKEICYALRAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIFTNATPDSHIMKKLSGN 749C2A91D7E6C95D methylcobalamin methylcobalamin CO-METHYLCOBALAMIN MeCbl mecobalamin methylcob(III)alamin Methylcobalamin methylcobalamin Coalpha-[alpha-(5,6-dimethylbenzimidazolyl)]-Cobeta-methylcobamide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) glutathione glutathione gamma-L-Glutamyl-L-cysteinyl-glycine 5-L-Glutamyl-L-cysteinylglycine Glutathione Glutathione-SH GSH N-(N-gamma-L-Glutamyl-L-cysteinyl)glycine Reduced glutathione L-gamma-glutamyl-L-cysteinylglycine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mmad_mouse Cobalamin trafficking protein CblD Methylmalonic aciduria and homocystinuria type D homolog, mitochondrial Mmadhc CblD protein protein mouse Mus musculus Mouse MAHVLCNRARLVSYLPGFCSLVKRVINPRAFSTAGSSGSDESHVATAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYVNEFQDSDAPVEQEINSAETYFESAKVECAIQTCPELLRRDFESLFPEVANSKLMILTVTQKTENDMTVWSEEVEVEREVLLEKFISGAKEICYALRAEGYWADFIDPSSGVAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIFTNATADSSIMRKLSGN 1E10849FD00CA21C mmachc-mmadhc-1 3 7 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 8 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1d mmachc-mmadhc-2 2 8 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1g glutathione-methylcobalamin-1 4 8 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9H3L0:p.Thr182Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T N Tue Jun 30 19:03:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr182Asn' Q9H3L0:p.Met186Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M A Tue Jun 30 19:34:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met186Ala' Q9H3L0:p.Trp189Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 19:25:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp189Ala' Q9H3L0:p.Asp226Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 17:40:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp226Ala' Q9H3L0:p.Leu259Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 17:08:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu259Pro' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified Q9Y4U1:p.Arg161Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 17:43:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg161Gln' p.Pro109_Arg111del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain PNR . ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5d, 1a, 1b, 1c, 1d glutathione-methylcobalamin-2 1 7 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 8 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 6a, 6b, 6c glutathione-methylcobalamin-3 4 7 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 8 cofactor cofactor coenzyme neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1f