IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. mmajetschak@luc.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-smooth-muscle rat smooth muscle smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. Rat VSMCs:- primary (aortic and mesenteric artery) vascular smooth muscle cells mmajetschak@luc.edu Accepted 2019-MAY-23 AT 10:47 BST AT 10:47 BST by LIVIAP Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Figure 1A is for individual receptors only - no interaction - interactions shown only in fig 1B. (methods state "Slides were then washed and incubated (1 h at 37°C) with secondary anti-rabbit antibodies conjugated with plus and minus Duolink II PLA probes"). I have added the so-called Positive controls. Regarding the X4-2-6 peptide:- can we discuss with Pablo before I alter anything? This peptide has the sequence of Human CXCR4 (plus two Aspartate residues + PEG) which only differs by 2 aas from Rat sequence - so the antibodies used here will directly bind to the peptide in competition with Rat endogenous CXCL4. So I dont think this would qualify as an "Antagonist" as MI definition is "Any chemical applied externally to cells.." and I would regard this as a "protein" not a "chemical"??; added positive control (ACKR3), please check it is still here; I have added it at least three times - (cloned from Expt-1) but it keeps on going back to the original experiment for some reason..; EBI-21284955 I have added Fig 1B to legend. Same comment about use of peptide X4-2–6 as an interactor rather than antagonist. the interactions do not need merging if not amalgamated and figure legends would be correct. I have altered the Comment at Publication level regarding lack of info on constructs so it says Supplementary figure 2 rather than Figure 2F(endogenous!!). Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. mmajetschak@luc.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. human hVSMCs:- primary (aortic) vascular smooth muscle cells mmajetschak@luc.edu Accepted 2019-MAY-23 AT 10:47 BST AT 10:47 BST by LIVIAP Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Figure 1A is for individual receptors only - no interaction - interactions shown only in fig 1B. (methods state "Slides were then washed and incubated (1 h at 37°C) with secondary anti-rabbit antibodies conjugated with plus and minus Duolink II PLA probes"). I have added the so-called Positive controls. Regarding the X4-2-6 peptide:- can we discuss with Pablo before I alter anything? This peptide has the sequence of Human CXCR4 (plus two Aspartate residues + PEG) which only differs by 2 aas from Rat sequence - so the antibodies used here will directly bind to the peptide in competition with Rat endogenous CXCL4. So I dont think this would qualify as an "Antagonist" as MI definition is "Any chemical applied externally to cells.." and I would regard this as a "protein" not a "chemical"??; added positive control (ACKR3), please check it is still here; I have added it at least three times - (cloned from Expt-1) but it keeps on going back to the original experiment for some reason..; EBI-21284955 I have added Fig 1B to legend. Same comment about use of peptide X4-2–6 as an interactor rather than antagonist. the interactions do not need merging if not amalgamated and figure legends would be correct. I have altered the Comment at Publication level regarding lack of info on constructs so it says Supplementary figure 2 rather than Figure 2F(endogenous!!). Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. mmajetschak@luc.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-smooth muscle Homo sapiens smooth_muscle smooth muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. human hVSMCs:- primary (aortic) vascular smooth muscle cells mmajetschak@luc.edu Accepted 2019-MAY-23 AT 10:47 BST AT 10:47 BST by LIVIAP Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Figure 1A is for individual receptors only - no interaction - interactions shown only in fig 1B. (methods state "Slides were then washed and incubated (1 h at 37°C) with secondary anti-rabbit antibodies conjugated with plus and minus Duolink II PLA probes"). I have added the so-called Positive controls. Regarding the X4-2-6 peptide:- can we discuss with Pablo before I alter anything? This peptide has the sequence of Human CXCR4 (plus two Aspartate residues + PEG) which only differs by 2 aas from Rat sequence - so the antibodies used here will directly bind to the peptide in competition with Rat endogenous CXCL4. So I dont think this would qualify as an "Antagonist" as MI definition is "Any chemical applied externally to cells.." and I would regard this as a "protein" not a "chemical"??; added positive control (ACKR3), please check it is still here; I have added it at least three times - (cloned from Expt-1) but it keeps on going back to the original experiment for some reason..; EBI-21284955 I have added Fig 1B to legend. Same comment about use of peptide X4-2–6 as an interactor rather than antagonist. the interactions do not need merging if not amalgamated and figure legends would be correct. I have altered the Comment at Publication level regarding lack of info on constructs so it says Supplementary figure 2 rather than Figure 2F(endogenous!!). Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. mmajetschak@luc.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-a7r5 Rattus norvegicus a7r5 a7r5 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. NMR experiments not annotated as done using cell membranes - so not a Direct interaction. For some reason I kept this publication back from being checked - no idea why, as no email was sent to authors...so now released for checking. Yes - an email WAS sent to authors ( 1/4/19) - no reply. mmajetschak@luc.edu Accepted 2019-MAY-23 AT 10:47 BST AT 10:47 BST by LIVIAP Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Figure 1A is for individual receptors only - no interaction - interactions shown only in fig 1B. (methods state "Slides were then washed and incubated (1 h at 37°C) with secondary anti-rabbit antibodies conjugated with plus and minus Duolink II PLA probes"). I have added the so-called Positive controls. Regarding the X4-2-6 peptide:- can we discuss with Pablo before I alter anything? This peptide has the sequence of Human CXCR4 (plus two Aspartate residues + PEG) which only differs by 2 aas from Rat sequence - so the antibodies used here will directly bind to the peptide in competition with Rat endogenous CXCL4. So I dont think this would qualify as an "Antagonist" as MI definition is "Any chemical applied externally to cells.." and I would regard this as a "protein" not a "chemical"??; added positive control (ACKR3), please check it is still here; I have added it at least three times - (cloned from Expt-1) but it keeps on going back to the original experiment for some reason..; EBI-21284955 I have added Fig 1B to legend. Same comment about use of peptide X4-2–6 as an interactor rather than antagonist. the interactions do not need merging if not amalgamated and figure legends would be correct. I have altered the Comment at Publication level regarding lack of info on constructs so it says Supplementary figure 2 rather than Figure 2F(endogenous!!). ackr3_rat Atypical chemokine receptor 3 Ackr3 Cmkor1 Cxcr7 Rdc1 C-X-C chemokine receptor type 7 Chemokine orphan receptor 1 G-protein coupled receptor RDC1 homolog protein protein rat Rattus norvegicus (Rat) Rat MDVHLFDYVEPGNYSDINWPCNSSDCIVVDTVQCPAMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTSTSSYKKKMVRRVVCVLVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK C47D1DD678697CFD cxcr4_rat C-X-C chemokine receptor type 4 Cxcr4 Cmkar4 Fusin Leukocyte-derived seven transmembrane domain receptor Stromal cell-derived factor 1 receptor protein protein rat Rattus norvegicus (Rat) Rat MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS 09D19860D3D2CB8A x4-2–6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FVITLPFWAVDAVANWYFGNDD ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV DIP protein P35348 original sequence version: 126 1A50487531DECDF0 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK A863EC1AFB5B158B ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF DIP protein P35368 original sequence version: 106 F081A23D2F943F7F ada1a_rat Alpha-1A adrenergic receptor Adra1a Adra1c Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor protein protein rat Rattus norvegicus (Rat) Rat MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTLHPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACTTARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV 4962D3A72E971A36 adra1a-cxcr4-4 4 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B adra1a-cxcr4-5 1 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B adra1a-cxcr4-6 2 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B,2B/D/E, 5D and Supplementary Figure 1. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-7 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 2B/D/E, 5E and Supplementary Figure 1. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-8 2 7 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH 2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 3 A/B X4-2–6 reduced the association between a1A-AR and CXCR4 and between a1B-AR and CXCR4. X4-2–6 (a peptide Derived from Transmembrane Domain 2 of CXCR4) reduced the association between a1A-AR and CXCR4 and between a1B-AR and CXCR4. adra1a-cxcr4-9 2 7 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 3 A/B-2 X4-2–6 (a peptide Derived from Transmembrane Domain 2 of CXCR4) reduced the association between a1A-AR and CXCR4 and between a1B-AR and CXCR4. adra1a-cxcr4-10 2 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B,3A/B, 5F PLA signals corresponding to CXCR4:ACKR3, however, were not affected by X4-2–6 (Fig. 3 A and B). PLA signals corresponding to CXCR4:ACKR3, however, were not affected by X4-2–6. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-11 4 7 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction SupplementaryFigure 3 ipokaslm-1 3 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figure 2F adra1a-cxcr4-15 1 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B,Supplementary figure 3 This is stated to be a positive control. ackr3-cxcr4-17 4 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1B, Supplementary figure 3 This is stated to be a positive control.