UniProt UniProt http://www.uniprot.org Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caov3 Homo sapiens Caov3 ovarian cancer cell line. caov3 Caov3 Human ovarian cancer cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caov3 Homo sapiens Caov3 ovarian cancer cell line. caov3 Caov3 Human ovarian cancer cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-es2 Human clear cell ovarian carcinoma cell line ES-2 es2 Human clear cell ovarian carcinoma cell line ES-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Human epididymis protein 4 in association with Annexin II promotes invasion and metastasis of ovarian cancer cells. Molecular cancer 2013 imex curation Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Zhuang H., Tan M., Liu J., Hu Z., Liu D., Gao J., Zhu L., Lin B. zhuanghuiyu88@sina.com Accepted 2020-FEB-25 AT 09:05 GMT AT 09:05 GMT by PPORRAS Molecular cancer 2013 Only protein-protein interactions imex curation imex curation wfdc2_human WAP four-disulfide core domain protein 2 Major epididymis-specific protein E4 Epididymal secretory protein E4 Putative protease inhibitor WAP5 WFDC2 HE4 WAP5 protein protein human Homo sapiens Human MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF 9536B00B385259AD acyp2_human Acylphosphatase-2 ACYP2 ACYP Acylphosphatase, muscle type isozyme Acylphosphate phosphohydrolase 2 protein protein human Homo sapiens Human MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY DIP protein P14621 original sequence version: 93 AEDE40E45B6207A0 tbb5_human Tubulin beta chain TUBB Tubulin beta-5 chain TUBB5 OK/SW-cl.56 protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA DIP protein P07437 original sequence version: 170 1E6CD0A36773A103 actn1_human Alpha-actinin-1 ACTN1 Alpha-actinin cytoskeletal isoform Non-muscle alpha-actinin-1 F-actin cross-linking protein protein protein human Homo sapiens Human MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 6DA3E4D1A0289519 tpm3_human Tropomyosin alpha-3 chain TPM3 Tropomyosin-3 Gamma-tropomyosin Tropomyosin-5 protein protein human Homo sapiens Human MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 99EAD24C45460A14 myh9_human Myosin-9 MYH9 Myosin heavy chain 9 Myosin heavy chain, non-muscle IIa Non-muscle myosin heavy chain IIa Cellular myosin heavy chain, type A Non-muscle myosin heavy chain A protein protein human Homo sapiens Human MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE DIP protein P35579 original sequence version: 126 DIP protein P35579-1 original sequence version: 142 DIP protein P35579-1 original sequence version: 133 DIP protein P35579 original sequence version: 186 DIP protein P35579-1 original sequence version: 186 DIP protein P35579-1 original sequence version: 146 DIP protein P35579 original sequence version: 146 588F84BB8C106E6F actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 5126E1337A0CBEA1 anxa2-wfdc2-17 6 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 1 wfdc2-anxa2-11 4 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2A anxa2-wfdc2-18 4 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2B anxa2-wfdc2-19 5 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2B, 2D wfdc2-anxa2-12 5 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2A, 2C anxa2-wfdc2-20 1 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2B, 2D wfdc2-anxa2-13 1 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2A,2C wfdc2-anxa2-14 3 14 unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2E anxa2-wfdc2-21 2 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 3E