IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of Rare, Single-Nucleotide Mutations in NDE1 and Their Contributions to Schizophrenia Susceptibility. Identification of Rare, Single-Nucleotide Mutations in NDE1 and Their Contributions to Schizophrenia Susceptibility. Schizophrenia bulletin 2015 imex curation Kimura H., Tsuboi D., Wang C., Kushima I., Koide T., Ikeda M., Iwayama Y., Toyota T., Yamamoto N., Kunimoto S., Nakamura Y., Yoshimi A., Banno M., Xing J., Takasaki Y., Yoshida M., Aleksic B., Uno Y., Okada T., Iidaka T., Inada T., Suzuki M., Ujike H., Kunugi H., Kato T., Yoshikawa T., Iwata N., Kaibuchi K., Ozaki N. Rare diseases - Interactions investigated in the context of Rare genetic disease branko@med.nagoya-u.ac.jp 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kimura H., Tsuboi D., Wang C., Kushima I., Koide T., Ikeda M., Iwayama Y., Toyota T., Yamamoto N., Kunimoto S., Nakamura Y., Yoshimi A., Banno M., Xing J., Takasaki Y., Yoshida M., Aleksic B., Uno Y., Okada T., Iidaka T., Inada T., Suzuki M., Ujike H., Kunugi H., Kato T., Yoshikawa T., Iwata N., Kaibuchi K., Ozaki N. Rare diseases - Interactions investigated in the context of Rare genetic disease branko@med.nagoya-u.ac.jp Accepted 2019-DEC-02 AT 15:18 GMT AT 15:18 GMT by LIVIAP Schizophrenia bulletin 2015 Only protein-protein interactions imex curation imex curation nde1_human Nuclear distribution protein nudE homolog 1 NDE1 NUDE protein protein human Homo sapiens Human MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC FC0BDD8BB90324B8 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 nde1-ywhae-1 1 3 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NXR1:p.Ser214Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 15:50:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser214Phe' Q9NXR1:p.Arg234Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:19:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Cys' Q9NXR1:p.Thr215Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 20:24:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr215Ala' Q9NXR1:p.Ser214Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:39:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser214Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2b ywhae-nde1-1 1 3 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NXR1:p.Ser214Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 17:39:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser214Phe' Q9NXR1:p.Arg234Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 16:25:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Cys' Q9NXR1:p.Thr215Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 16:10:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr215Ala' Q9NXR1:p.Ser214Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:38:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser214Ala' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Figure S4