UniProt UniProt http://www.uniprot.org AlphaScreen HTS and live-cell bioluminescence resonance energy transfer (BRET) assays for identification of Tau-Fyn SH3 interaction inhibitors for Alzheimer disease. AlphaScreen HTS and live-cell bioluminescence resonance energy transfer (BRET) assays for identification of Tau-Fyn SH3 interaction inhibitors for Alzheimer disease. Journal of biomolecular screening 2014 imex curation Cochran JN., Diggs PV., Nebane NM., Rasmussen L., White EL., Bostwick R., Maddry JA., Suto MJ., Roberson ED. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease eroberson@uab.edu 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Cochran JN., Diggs PV., Nebane NM., Rasmussen L., White EL., Bostwick R., Maddry JA., Suto MJ., Roberson ED. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease AlphaScreen relies on the use of “Donor” and “Acceptor” beads coated with a layer of hydrogel providing functional groups for bioconjugation. When a biological interaction between molecules brings the beads into proximity, a cascade of chemical reactions is initiated to produce a greatly amplified signal. eroberson@uab.edu Accepted 2019-AUG-19 AT 08:16 BST AT 08:16 BST by MGT Journal of biomolecular screening 2014 imex curation I have no idea why we don't have the Tau isoform designations in UniProt - to be honest, you'll probably get further with getting it done than I would, if you put a formal request in www.uniprot.org/update?entry=P10636 AlphaScreen HTS and live-cell bioluminescence resonance energy transfer (BRET) assays for identification of Tau-Fyn SH3 interaction inhibitors for Alzheimer disease. AlphaScreen HTS and live-cell bioluminescence resonance energy transfer (BRET) assays for identification of Tau-Fyn SH3 interaction inhibitors for Alzheimer disease. Journal of biomolecular screening 2014 imex curation Cochran JN., Diggs PV., Nebane NM., Rasmussen L., White EL., Bostwick R., Maddry JA., Suto MJ., Roberson ED. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease eroberson@uab.edu 30-Aug-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag visualisation tag visualisation Cochran JN., Diggs PV., Nebane NM., Rasmussen L., White EL., Bostwick R., Maddry JA., Suto MJ., Roberson ED. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease eroberson@uab.edu Accepted 2019-AUG-19 AT 08:16 BST AT 08:16 BST by MGT Journal of biomolecular screening 2014 imex curation I have no idea why we don't have the Tau isoform designations in UniProt - to be honest, you'll probably get further with getting it done than I would, if you put a formal request in www.uniprot.org/update?entry=P10636 tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636 original sequence version: 125 DIP protein P10636 original sequence version: 210 D46C66CDBCD196E8 p10636-5 Microtubule-associated protein tau MAPT MAPTL MTBT1 TAU Tau-3 Neurofibrillary tangle protein Paired helical filament-tau 2N3R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL A76B304E99E6A978 p10636-7 Microtubule-associated protein tau MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 1N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL 0D4EABCA15179E7D p10636-6 Microtubule-associated protein tau MAPT MAPTL MTBT1 Neurofibrillary tangle protein Paired helical filament-tau TAU 0N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL mint F3256B0AB87B348D p10636-4 Microtubule-associated protein tau MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 1N3R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL EA206819FE73B67A p10636-2 Microtubule-associated protein tau MAPT MAPTL MTBT1 Neurofibrillary tangle protein Paired helical filament-tau TAU 0N3R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL mint 9B26AEDFF4D2677C p10636-8 Microtubule-associated protein tau Tau-4 MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 2N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636-8 original sequence version: 206 DIP protein P10636-8 original sequence version: 203 DIP protein P10636-8 original sequence version: 166 DIP protein P10636-8 original sequence version: 218 835A8706D847A8CC fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL DIP protein P06241 original sequence version: 195 DIP protein P06241 original sequence version: 147 DIP protein P06241 original sequence version: 164 4A1E443A4B5A0977 fyn-mapt-4 1 9 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P10636-8:p.Pro203Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 17:47:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro203Ala' P10636-8:p.Pro216Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 18:12:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro216Ala' P10636-8:p.Arg221Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Thu Jul 11 16:34:51 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro221Ala' Tue Jun 30 19:24:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg221Ala' P10636-8:p.Pro232Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 19:51:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro232Ala' P10636-8:p.Pro233Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 17:09:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro233Ala' P10636-8:p.Pro236Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 16:16:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro236Ala' P10636-8:p.[Ser199Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Tue Mar 19 11:32:22 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser199:Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu]' Tue Jun 30 16:51:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser199Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu]' P10636-8:p.Ser202Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 17:06:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser202Glu' P10636-8:p.Thr231Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T E Tue Jun 30 16:49:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr231Glu' P10636-8:p.[Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Tue Jun 30 18:40:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu]' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, 1C, 1D, 2C, 3B, 3D MAPT 4R2N form fyn-mapt-5 1 10 competitor competitor competitor neutral component neutral component purified purified sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1C fyn-mapt-6 1 4 competitor competitor competitor neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1C fyn-mapt-7 1 6 unspecified role unspecified role neutral component neutral component C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 competitor competitor competitor neutral component neutral component purified purified c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1C fyn-mapt-8 1 3 competitor competitor competitor neutral component neutral component n-terminal tat tag transactivating tag Tat tag tat tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1D, 2B fyn-mapt-9 1 3 competitor competitor competitor neutral component neutral component n-terminal tat tag transactivating tag Tat tag tat tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component protein delivery protein delivery n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2B fyn-mapt-10 1 6 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3D MAPT 4R0N form fyn-mapt-11 1 5 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3D MAPT 4R1N form fyn-mapt-12 1 8 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3D MAPT 3R0N form fyn-mapt-13 1 7 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3D MAPT 3R1N form fyn-mapt-14 1 4 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3D MAPT 3R2N form fyn-mapt-15 2 9 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed c-terminal mkate2 mkate2 c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal mkate2 mkate2 n-term range n-terminal range n-term range n-term range n-terminal range n-term range P10636-8:p.[Ser199Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Tue Mar 19 12:04:24 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser199:Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu]' Tue Jun 30 18:12:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser199Glu;Ser202Glu;Thr205Glu;Ser262Glu;Ser293Glu;Ser324Glu;Ser356Glu]' 10 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed c-terminal green click beetle luciferase luciferase tag luciferase tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range proximity proximity close-contact colocalization neighbourhood interaction Fig. 5D-F MAPT 4R2N form A monobody which binds selectively to the Fyn SH3 domain completely inhibited the WT Tau–Fyn SH3 interaction but only partially inhibited the D-Tau–Fyn SH3 interaction. fyn-mapt-16 2 9 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed n-terminal mkate2 mkate2 n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range c-terminal green click beetle luciferase luciferase tag luciferase tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 5B MAPT 4R2N form Tau peptide 547-559 (P10636) fyn-mapt-17 2 9 unspecified role unspecified role luminescence accept luminescence acceptor luminescence accept over-expressed over expressed level over-expressed c-terminal mkate2 mkate2 n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role luminescence donor luminescence donor over-expressed over expressed level over-expressed sh3 region sufficient to bind sufficient binding region sufficient to bind range range range range c-terminal green click beetle luciferase luciferase tag luciferase tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 5B MAPT 4R2N form Tau peptide 547-559 (P10636)