UniProt UniProt http://www.uniprot.org FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. pull down pull down western blot western blot Immuno blot Immuno blot Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT Human brain cDNA FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 imex curation Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cheung HN., Dunbar C., Mórotz GM., Cheng WH., Chan HY., Miller CC., Lau KF. Interactions involving PAK1 could not be captured as the kit did not supply details of the species of origin of this construct. kflau@cuhk.edu.hk Accepted 2019-JUN-13 AT 09:22 BST AT 09:22 BST by MGT FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Only protein-protein interactions imex curation imex curation 1F in cheung-2014-4, 1D in cheung-2014-11; I've reluctantly added the GGA3 data as the construct currently sold does not appear to be the same as in 2014, its now agarose-linked, not GST-tagged, so can only hope it was still human. Delete if not happy with this. apbb1_human Amyloid beta precursor protein binding family B member 1 APBB1 FE65 RIR Protein Fe65 Amyloid-beta A4 precursor protein-binding family B member 1 protein protein human Homo sapiens Human MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP DIP protein O00213 original sequence version: 77 FD4A2EF7E8D8E884 pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B apbb1_rat Amyloid beta precursor protein binding family B member 1 Protein Fe65 Apbb1 Fe65 Amyloid-beta A4 precursor protein-binding family B member 1 Rir protein protein rat Rattus norvegicus (Rat) Rat MSVPSSLSQSAINANSHGGPALSFPFPLHAAHNQLLNAKLQATAVVPKDLRSAMGEGSVPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEAETAPLGPKGLMHLYSELELSAHNAANRGLHGSALIINTQGLGPDEGEEKAAGEVEEEDEDEEEEDEEEEDLSSPQGLPEPLENVEVPSGPQVLTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGNSPQEESQLTWTGFAHQEGFEEGEFWKDEPSEEAPMELGLKDPEEGTLPFSAQSLSPEPVPQEEENLPQRNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQNQTLLHAQPIVSIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMSERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQTSTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGSQTP A6C9820F5D2BD7BE a0a3l7hq44_crigr CgPICR_011709 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 g3imu0_crigr ADP-ribosylation factor 6 CgPICR_008218 I79_025237 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS 49E38E59AEA52B98 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 arf6_rat ADP-ribosylation factor 6 Arf6 protein protein rat Rattus norvegicus (Rat) Rat MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS 49E38E59AEA52B98 gga3_human ADP-ribosylation factor-binding protein GGA3 Golgi-localized, gamma ear-containing, ARF-binding protein 3 GGA3 KIAA0154 protein protein human Homo sapiens Human MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL DIP protein Q9NZ52 original sequence version: 134 4F80D6032239168C apbb1-arf6-1 3 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ptb_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association From a yeast 2-hybrid screen of a human brain cDNA library using FE65 PTB1 + 2 domain as bait, we isolated a cDNA clone encoding the small GTPase ARF6. arf6-apbb1-1 6 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 1A apbb1-arf6-3 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level ptb1_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B, 1E arf6-apbb1-2 7 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 4 To determine whether FE65 and ARF6 colocalize in growth cones, we immunostained neurons and utilized intensity correlation analyses (ICAs; ref. 37) to determine whether there was significant overlap in the distribution of the two proteins in growth cones. arf6-apbb1-3 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1B arf6-apbb1-4 1 13 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1G apbb1-arf6-2 2 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptb1_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P62330:p.Thr27Asn mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T N Tue Jun 30 16:16:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr27Asn' P62330:p.Gln67Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 19:55:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' physical association physical association Fig. 2A GST-FE65 PTB1 was pulled down from the transfected cell lysates, and the amounts of bound ARF6 were detected by immunoblotting. apbb1-arf6-4 1 8 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptb1_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P62330:p.Gln67Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:43:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' P62330:p.Thr27Asn mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain T N Tue Jun 30 17:36:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr27Asn' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 2B, 2C GDP (CHEBI:17552) Guanosine 5'-[γ-thio]triphosphate (CHEBI:43000) gga3-arf6-2 1 15 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P62330:p.Gln67Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 16:34:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' P62330:p.Thr27Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T N Tue Jun 30 16:42:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr27Asn' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 2B gga3-arf6-3 1 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 15 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2C Guanosine 5'-[γ-thio]triphosphate (CHEBI:43000) gga3-arf6-4 6 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 15 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2C Guanosine 5'-[γ-thio]triphosphate (CHEBI:43000) arf6-apbb1-5 5 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1C To demonstrate that endogenous FE65 interacts with endogenous ARF6, we immunoprecipitated ARF6 from rat brain and probed these immunoprecipiates for FE65. a0a3l7hq44_crigr-pak1-1 6 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association PAK1 only bind activated RAC1 whcih means the protein was GTP-bound. Overexpression of APBB1 by transfection increased Rac1 activation, whereas siRNA knockdown of APBB1 reduced Rac1 activation in these assays Figs. 3C-3E arf6-apbb1-6 2 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1F apbb1-arf6-5 2 8 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptb1_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1D