IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Disease-causing mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling. Disease-causing mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling. EMBO molecular medicine 2013 imex curation Damgaard RB., Fiil BK., Speckmann C., Yabal M., zur Stadt U., Bekker-Jensen S., Jost PJ., Ehl S., Mailand N., Gyrd-Hansen M. Rare diseases - Interactions investigated in the context of Rare genetic disease mads.gyrd@cpr.ku.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Damgaard RB., Fiil BK., Speckmann C., Yabal M., zur Stadt U., Bekker-Jensen S., Jost PJ., Ehl S., Mailand N., Gyrd-Hansen M. Rare diseases - Interactions investigated in the context of Rare genetic disease mads.gyrd@cpr.ku.dk Accepted 2020-MAR-04 AT 17:27 GMT AT 17:27 GMT by MGT EMBO molecular medicine 2013 Only protein-protein interactions imex curation imex curation Disease-causing mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling. Disease-causing mutations in the XIAP BIR2 domain impair NOD2-dependent immune signalling. EMBO molecular medicine 2013 imex curation Damgaard RB., Fiil BK., Speckmann C., Yabal M., zur Stadt U., Bekker-Jensen S., Jost PJ., Ehl S., Mailand N., Gyrd-Hansen M. Rare diseases - Interactions investigated in the context of Rare genetic disease mads.gyrd@cpr.ku.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Damgaard RB., Fiil BK., Speckmann C., Yabal M., zur Stadt U., Bekker-Jensen S., Jost PJ., Ehl S., Mailand N., Gyrd-Hansen M. Rare diseases - Interactions investigated in the context of Rare genetic disease mads.gyrd@cpr.ku.dk Accepted 2020-MAR-04 AT 17:27 GMT AT 17:27 GMT by MGT EMBO molecular medicine 2013 Only protein-protein interactions imex curation imex curation hoil1_human RanBP-type and C3HC4-type zinc finger-containing protein 1 RBCK1 C20orf18 RNF54 UBCE7IP3 XAP3 XAP4 Ubiquitin-conjugating enzyme 7-interacting protein 3 Hepatitis B virus X-associated protein 4 HBV-associated factor 4 RING finger protein 54 Heme-oxidized IRP2 ubiquitin ligase 1 RING-type E3 ubiquitin transferase HOIL-1 protein protein human Homo sapiens Human MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH DIP protein Q9BYM8 original sequence version: 114 DIP protein Q9BYM8 original sequence version: 124 DIP protein Q9BYM8-1 original sequence version: 102 DIP protein Q9BYM8 original sequence version: 102 DIP protein Q9BYM8-1 original sequence version: 107 DIP protein Q9BYM8-1 original sequence version: 126 C6EF957B1F152FF2 q9jiq3-pro_0000021073 Diablo homolog, mitochondrial Direct IAP-binding protein with low pI Second mitochondria-derived activator of caspase Diablo Smac protein protein mouse Mus musculus Mouse AVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED 54 237 052B6A0BF55D02B7 xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 tab1_human TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 TAB1 MAP3K7IP1 TGF-beta-activated kinase 1-binding protein 1 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 protein protein human Homo sapiens Human MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP DIP protein Q15750 original sequence version: 74 DIP protein Q15750 original sequence version: 110 DIP protein Q15750 original sequence version: 111 A45743288718983A shrpn_human Sharpin SHARPIN SIPL1 Shank-associated RH domain-interacting protein Shank-interacting protein-like 1 PSEC0216 protein protein human Homo sapiens Human MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST DIP protein Q9H0F6 original sequence version: 80 DIP protein Q9H0F6 original sequence version: 89 DIP protein Q9H0F6-1 original sequence version: 68 DIP protein Q9H0F6 original sequence version: 68 DIP protein Q9H0F6-1 original sequence version: 72 DIP protein Q9H0F6 original sequence version: 91 33EE4BF66936AB60 ripk2_human Receptor-interacting serine/threonine-protein kinase 2 RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092 RIP-like-interacting CLARP kinase Receptor-interacting protein 2 CARD-containing interleukin-1 beta-converting enzyme-associated kinase Tyrosine-protein kinase RIPK2 protein protein human Homo sapiens Human MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM DIP protein O43353 original sequence version: 159 DIP protein O43353-1 original sequence version: 116 DIP protein O43353 original sequence version: 116 575A692239505792 nod2_human Nucleotide-binding oligomerization domain-containing protein 2 IBD1 NOD2 CARD15 Caspase recruitment domain-containing protein 15 Inflammatory bowel disease protein 1 protein protein human Homo sapiens Human MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL DIP protein Q9HC29 original sequence version: 141 DIP protein Q9HC29 original sequence version: 77 DIP protein Q9HC29-1 original sequence version: 100 DIP protein Q9HC29-1 original sequence version: 106 mint homomint Induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS) Defects in NOD2 are the cause of Blau syndrome (BS) [MIM:186580]. BS is a rare autosomal dominant disorder characterized by early-onset granulomatous arthritis, uveitis and skin rash Defects in NOD2 are a cause of susceptibility to Crohn disease (CD) [MIM:266600]. CD is a form of remitting inflammatory bowel disease (IBD). CD may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous. Crohn disease is commonly classified as autoimmune disease Defects in NOD2 are a cause of susceptibility to ulcerative colitis [MIM:191390]. It is a chronic inflammatory bowel disease. In ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers. Ulcerative colitis is commonly classified as autoimmune disease Defects in NOD2 are the cause of early-onset sarcoidosis (EOS) [MIM:609464]. Sarcoidosis is a multiorganic inflammatory disease with unknown etiology, characterized by the histologic features of non-caseating epithelioid granulomas. In childhood, 2 distinct types of sarcoidosis have been described. Usually the disease is detected in older children by chest radiography and the clinical manifestations are characterized by a classical triad of lung, lymph node, and eye involvement, similar to those in adults. In contrast, early-onset sarcoidosis (EOS), which usually appears in those younger than 4 years of age, is quite rare and has a distinct triad of skin, joint, and eye disorders, without apparent pulmonary involvement. Compared with an asymptomatic and sometimes naturally disappearing course of the disease in older children, EOS is progressive and in many cases causes severe complications, such as blindness, joint destruction, and visceral involvement 0037592D96D7DDFF rnf31_human E3 ubiquitin-protein ligase RNF31 Zinc in-between-RING-finger ubiquitin-associated domain protein RNF31 ZIBRA HOIL-1-interacting protein RING finger protein 31 RING-type E3 ubiquitin transferase RNF31 protein protein human Homo sapiens Human MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTFCNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK DIP protein Q96EP0 original sequence version: 118 DIP protein Q96EP0-1 original sequence version: 145 DIP protein Q96EP0-1 original sequence version: 91 DIP protein Q96EP0 original sequence version: 91 DIP protein Q96EP0-1 original sequence version: 98 DIP protein Q96EP0-1 original sequence version: 120 CFAD183A14F764BA ripk2-xiap-8 2 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4a xiap-ripk2-4 2 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell p.Val198Met mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain V M region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p.Gly188Glu mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain G E p.Cys203Tyr mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain C Y p.Leu207Pro mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain L P p.Arg166Ile mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain R I p.Trp173Gly mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain W G association association Fig. 4b nod2-rbck1-1 1 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 10 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Gly188Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G E Tue Jun 30 16:01:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly188Glu' P98170:p.Cys203Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 16:49:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys203Tyr' P98170:p.Leu207Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 16:07:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu207Pro' P98170:p.Arg166Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R I Tue Jun 30 17:18:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg166Ile' association association Fig. 4e xiap-ripk2-5 2 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P98170:p.His223Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain H V Tue Jun 30 16:35:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His223Val' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Asp214Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D S Tue Jun 30 18:57:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp214Ser' bir2 domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P98170:p.Leu207Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 16:25:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu207Pro' P98170:p.Glu219Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E R Tue Jun 30 17:01:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu219Arg' P98170:p.Trp310Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 17:55:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp310Ala' physical association physical association Fig. 5c, 6c, 6h A bivalent Smac mimetic compound (SMC)"Compound A" (CpA). CpA failed to efficiently displace RIPK2 from the XIAP-H223V mutant. xiap-ripk2-6 2 4 competitor competitor competitor prey prey over-expressed over expressed level over-expressed living cell living cell c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell bir2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Trp310Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 17:25:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp310Ala' association association Fig. 5e/f Ub‐Smac fusion had been used, which is rapidly cleaved to generate the mature form of Smac (Hunter et al, 2003 - 12511567) xiap-ripk2-7 2 4 competitor competitor competitor prey prey over-expressed over expressed level over-expressed living cell living cell c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9JIQ3-PRO_0000021073:p.Pro3_Ile4delinsAlaVal mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain PI AV Tue Jun 30 16:59:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro3_Ile4delinsAlaVal' Q9JIQ3-PRO_0000021073:p.Ala1Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A L Tue Jun 30 19:49:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala1Leu' 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P98170:p.Trp310Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 16:51:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp310Ala' 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 5f Ub‐Smac fusion had been used, which is rapidly cleaved to generate the mature form of Smac (Hunter et al, 2003 - 12511567) N-terminal AVPI mutated to AVAV increased the antagonistic affect of Smac, whereas Smac lacking the essential N‐terminal alanine (Smac LVPI) did not bind the BIR2 and was unable to antagonize RIPK2 binding Smac partially impaired the binding of RIPK2 to the isolated XIAP BIR2 domain xiap-ripk2-8 2 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P98170:p.Val198Met mutation mutation certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 16:42:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val198Met' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Gly188Glu mutation mutation certain certain sequence position certain certain certain sequence position certain G E Tue Jun 30 18:47:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly188Glu' P98170:p.Cys203Tyr mutation mutation certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 18:06:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys203Tyr' P98170:p.Leu207Pro mutation mutation certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 16:57:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu207Pro' P98170:p.Arg166Ile mutation mutation certain certain sequence position certain certain certain sequence position certain R I Tue Jun 30 19:36:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg166Ile' P98170:p.Trp173Gly mutation mutation certain certain sequence position certain certain certain sequence position certain W G Tue Jun 30 15:36:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp173Gly' physical association physical association Fig. 4b xiap-ripk2-10 2 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell bir2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Trp310Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 20:04:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp310Ala' physical association physical association Fig. 5e/f xiap-diablo-4 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell c-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell bir2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98170:p.Trp310Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Tue Jun 30 16:25:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp310Ala' physical association physical association Fig. 5e/f Ub‐Smac fusion had been used, which is rapidly cleaved to generate the mature form of Smac (Hunter et al, 2003 - 12511567)