IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Molecular psychiatry 2013 imex curation Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se Accepted 2019-SEP-23 AT 12:59 BST AT 12:59 BST by PPORRAS Molecular psychiatry 2013 Only protein-protein interactions imex curation imex curation Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Molecular psychiatry 2013 imex curation Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se Accepted 2019-SEP-23 AT 12:59 BST AT 12:59 BST by PPORRAS Molecular psychiatry 2013 Only protein-protein interactions imex curation imex curation Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Evidence for the existence of dopamine D2-oxytocin receptor heteromers in the ventral and dorsal striatum with facilitatory receptor-receptor interactions. Molecular psychiatry 2013 imex curation Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Romero-Fernandez W., Borroto-Escuela DO., Agnati LF., Fuxe K. emails sent for BRET assay 3/6/19 but no reply expected as corresponding author does not. Results from BRET assay (Supplementary figure 4) have not been included as species origins of constructs used are not stated nor are there any relevant references. The authors have not replied to a request for information. kjell.Fuxe@ki.se Accepted 2019-SEP-23 AT 12:59 BST AT 12:59 BST by PPORRAS Molecular psychiatry 2013 Only protein-protein interactions imex curation imex curation oxyr_rat Oxytocin receptor Oxtr Otr protein protein rat Rattus norvegicus (Rat) Rat MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACVLLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDVNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETSVSKKSNSSTFVLSRRSSSQRSCSQPSSA FC738B254005CDD0 oxyr_human Oxytocin receptor OXTR protein protein human Homo sapiens Human MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA drd2_rat D(2) dopamine receptor Drd2 Dopamine D2 receptor protein protein rat Rattus norvegicus (Rat) Rat MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC DIP protein P61169 original sequence version: 64 216E56CEE5CA32FB drd2_human D(2) dopamine receptor DRD2 Dopamine D2 receptor protein protein human Homo sapiens Human MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 9BF8EA36C988A2E2 drd2-oxtr-1 3 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Figure 1, Supplementary figure 1 Heteromers were seen in the neuropil of Acb (Nucleus accumbens) and in the dorsal striatum. drd2-oxtr-2 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization Supplementary Figure 2 I cannot see any indication as to where co-loc is taking place within cell - probably cell membrane? Even the colocalisation looks suspect. drd2-oxtr-3 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction Supplementary Figure 3