IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de Accepted 2019-OCT-04 AT 15:46 BST AT 15:46 BST by LIVIAP Journal of immunology (Baltimore, Md. : 1950) 2011 Only protein-protein interactions imex curation imex curation Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. C3b is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de Accepted 2019-OCT-04 AT 15:46 BST AT 15:46 BST by LIVIAP Journal of immunology (Baltimore, Md. : 1950) 2011 Only protein-protein interactions imex curation imex curation Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro peptide array peptide array antibody detection identification by antibody antibody detection Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de Accepted 2019-OCT-04 AT 15:46 BST AT 15:46 BST by LIVIAP Journal of immunology (Baltimore, Md. : 1950) 2011 Only protein-protein interactions imex curation imex curation Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Complement regulation at necrotic cell lesions is impaired by the age-related macular degeneration-associated factor-H His402 risk variant. Journal of immunology (Baltimore, Md. : 1950) 2011 imex curation Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay antibody detection identification by antibody antibody detection Lauer N., Mihlan M., Hartmann A., Schlötzer-Schrehardt U., Keilhauer C., Scholl HP., Charbel Issa P., Holz F., Weber BH., Skerka C., Zipfel PF. C3b is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. not included co-loc in Figs 6 (and 4 and Supp.5) as although Fig 4 looks to be colocalisation, no merge is shown and Fig 6 only shows co-loc. with Annexin, and it is unclear if CRP and Factor H alone are colocalising. Peter.Zipfel@hki-jena.de Accepted 2019-OCT-04 AT 15:46 BST AT 15:46 BST by LIVIAP Journal of immunology (Baltimore, Md. : 1950) 2011 Only protein-protein interactions imex curation imex curation p01024-pro_0000005911 Complement C3b alpha' chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN 749 1663 1E32EA0CEA20EA81 crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 cfai_human Complement factor I CFI IF C3B/C4B inactivator protein protein human Homo sapiens Human MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV F06070EFE6B572A1 p08603-1 Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR 3C26D62A2BF9BFEE p08603-2 Complement factor H CFH HF HF1 HF2 FHL-1 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL C2AAD47F155343E3 p01024-pro_0000005908 Complement C3 beta chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAA 23 667 C4754001F1A97259 cfh-crp-1 1 6 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified P08603-1:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:21:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' human-plasma homo sapiens blood plasma plasma blood plasma direct interaction direct interaction 1A mCRP, but not pCRP, binds to Factor H Monomeric CRP, but not polymeric CRP, binds to Factor H. cfh-crp-2 3 6 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B/C c3-cfh-14 4 8 cofactor cofactor coenzyme neutral component neutral component purified purified P08603-1:p.Tyr402His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 18:00:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' human-plasma homo sapiens blood plasma plasma blood plasma 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 7 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Supp. figure 4A c3-cfh-15 4 6 stimulator stimulator neutral component neutral component purified purified 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 8 cofactor cofactor coenzyme neutral component neutral component purified purified P08603-1:p.Tyr402His mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:01:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' human-plasma homo sapiens blood plasma plasma blood plasma 7 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Supp. figure 4A-2 c3-cfh-16 2 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 7 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum 8 cofactor cofactor coenzyme neutral component neutral component purified purified P08603-1:p.Tyr402His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:50:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' human-plasma homo sapiens blood plasma plasma blood plasma protein cleavage protein cleavage Supp. figure 4B c3-cfh-17 2 6 stimulator stimulator neutral component neutral component purified purified 10 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 8 cofactor cofactor coenzyme neutral component neutral component purified purified P08603-1:p.Tyr402His mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 15:38:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' human-plasma homo sapiens blood plasma plasma blood plasma 7 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Supp. figure 4B-2 cfh-crp-3 1 6 unspecified role unspecified role prey prey purified purified 9 unspecified role unspecified role bait bait purified purified P08603-2:p.Tyr402His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y H Tue Jun 30 17:50:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr402His' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Supplementary Fig. 5A