IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. PloS one 2010 imex curation Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk Accepted 2019-MAY-02 AT 14:19 BST AT 14:19 BST by PPORRAS PloS one 2010 Only protein-protein interactions imex curation imex curation GPR50 cytoplasmic domain range corrected; Truncated Gpr50's range corrected; Interacting partners: TBC1 domain family, member 19 was ignored previously as it had only the TrEMBL id; the rest of the interacting partners are not specific enough to pick up UniProtKB id - data-processing comment added; library used annotation updated GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. PloS one 2010 imex curation Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. Table 1 preys, Gametogentin, Syndecan binding protein 8 and Spermatogenesis were not found to have UniProtKB id, so not able to capture as interaction in Y2H assay david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk Accepted 2019-MAY-02 AT 14:19 BST AT 14:19 BST by PPORRAS mouse testis cDNA library PloS one 2010 Only protein-protein interactions imex curation imex curation GPR50 cytoplasmic domain range corrected; Truncated Gpr50's range corrected; Interacting partners: TBC1 domain family, member 19 was ignored previously as it had only the TrEMBL id; the rest of the interacting partners are not specific enough to pick up UniProtKB id - data-processing comment added; library used annotation updated GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. GPR50 interacts with TIP60 to modulate glucocorticoid receptor signalling. PloS one 2010 imex curation Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Li J., Hand LE., Meng QJ., Loudon AS., Bechtold DA. david.bechtold@manchester.ac.uk,andrew.loudon@manchester.ac.uk Accepted 2019-MAY-02 AT 14:19 BST AT 14:19 BST by PPORRAS PloS one 2010 Only protein-protein interactions imex curation imex curation GPR50 cytoplasmic domain range corrected; Truncated Gpr50's range corrected; Interacting partners: TBC1 domain family, member 19 was ignored previously as it had only the TrEMBL id; the rest of the interacting partners are not specific enough to pick up UniProtKB id - data-processing comment added; library used annotation updated aka10_mouse A-kinase anchor protein 10, mitochondrial Protein kinase A-anchoring protein 10 Dual specificity A kinase-anchoring protein 2 Akap10 protein protein mouse Mus musculus Mouse MRGAGPSPRHSPRALRPDPGPAMSFFRRKVKGKEQEKTLDVKSTKASVAVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLRDTVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKRHETPASSVTEALDRRLGDSSSAPLLVTQSEGTDLSSRTQNPQNHLLLSQEGHSARSLHREVARTGSHQIPTDSQDSSSRLAVGSRNSCSSPLRELSEKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQAVVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLPEESHSGGSDGSTAQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMSFGRVSDLGQFIRESEPEPDVKKSKGFMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAHHDQPLEKSTKL CB31AF0DF13B3AE6 pex2_mouse Peroxisome biogenesis factor 2 Pex2 Paf1 Pxmp3 Pmp35 Peroxin-2 Peroxisomal membrane protein 3 Peroxisome assembly factor 1 protein protein mouse Mus musculus Mouse MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQHKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERCYDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKPQNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCTLCTGAAGHDSTLGSSGKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKAGIQMSEVNAL FAFB6C8913F959F0 ctxn1_mouse Cortexin-1 Ctxn1 Ctxn protein protein mouse Mus musculus Mouse MSSAWTLSPEPLPPSTGPPVGAGLDVEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV 17B789079CF0E0D4 kat5_mouse Histone acetyltransferase KAT5 Kat5 Htatip Tip60 Lysine acetyltransferase 5 Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein mouse Mus musculus Mouse MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW EACEE4D544C0DB60 q8vdv7_mouse Tbc1d19 protein protein mouse Mus musculus Mouse MLQEESDLSLIIAQIVQKLKGSNLYAQLERQAWSCLQRPEIRLESLKEDIKEFFKISGWEKKLQNAVYSELNVFPLPSHPSAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPAMEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKECFVELGLNTGQLGIDDSTQVPPELFENEHVRIGQKVLAQQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDILYYEQLKTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLGHFAYNSASPPKSYIRGKLGLEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPYKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAVNLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT 16A407253A0368C3 mtr1l_mouse Melatonin-related receptor G protein-coupled receptor 50 H9 Gpr50 protein protein mouse Mus musculus Mouse MATVPKSNMGPTKAVPTPFGCIGCKLPKPDYPPALIIFMFCAMVITVVVDLIGNSMVILAVTKNKKLRNSGNIFVASLSVADMLVAIYPYPLMLYAMSVGGWDLSQLQCQMVGLVTGLSVVGSIFNITAIAINRYCYICHSLQYKRIFSLRNTCIYLVVTWVMTVLAVLPNMYIGTIEYDPRTYTCIFNYVNNPAFTVTIVCIHFVLPLIIVGYCYTKIWIKVLAARDPAGQNPDNQFAEVRNFLTMFVIFLLFAVCWCPVNVLTVLVAVIPKEMAGKIPNWLYLAAYCIAYFNSCLNAIIYGILNESFRREYWTIFHAMRHPILFISHLISDIRETWETRALTRARVRARDQVREQERARACVAVEGTPRNVRNVLLPGDASAPHSDRASVRPKPQTRSTSVYRKPASIHHKSISGHPKSASVYPKPASSVHCKPASVHFKPASVHFKGDSVYFKGDTVHYRAASKLVTSHRISAGPSTSHPTSMAGYIKSGTSHPATTTVDYLEPATTSHSVLTAVDLPEVSASHCLEMTSTGHLRADISASVLPSVPFELAATPPDTTAIPIASGDYRKVVLIDDDSDDSDCSDEMAV 12576D50C20E216A snx5_mouse Sorting nexin-5 Snx5 protein protein mouse Mus musculus Mouse MAAVPELLEQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFSGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN C24D8C78F753FAFC kif9_mouse Kinesin-like protein KIF9 Kif9 protein protein mouse Mus musculus Mouse MGTRKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQGIFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALRRKYTLIDKNDFAAISAVQKVGLMDIEGNLVGEPDGQSFGLGVAPFSVKPGKKPKTKKTPKDQFSSSARKEGASSPVSGKDFDVASISKTQLIPSSKDGDLKDMLARERETSSIEPLISDSPKEELRAPRPSTPPSRTVAFEEFKNERGSEINRIFKENKSILNERKKRASETTQRINAIKQEIDETKDALNFQKSLREKQGEYENKGLMIIDEEEFLLILKLKDLKKQYRNEYQELRDLRAEIQYCQRLVDQCRHRLLMEFDIWYNESFMIPEDVQVALKLGSSIRPGMVPISRIVCLGEDDQDRFSHLQQTVLPEGLDSITFYNAKVKTDQKHNYMKTMVGLQQSHRK 0E43EFE48342ECE7 snx6_mouse Sorting nexin-6 Snx6 protein protein mouse Mus musculus Mouse MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDRVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT mint May be involved in several stages of intracellular trafficking 7B33A7325B814DAF gpr50-kat5-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-1 2 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-snx5-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-snx6-1 2 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-kif9-1 2 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-akap10-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-pex2-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 gpr50-kat5-2 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1f,1g gpr50-kat5-3 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Figure 2a, 2b, 2c gpr50-tbc1d19-1 2 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1