IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. The Journal of biological chemistry 2011 imex curation Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuro_2_a Mus musculus albino neuroblastoma cell line neuro 2 a (N2a) neuro_2_a Mouse Albino neuroblastoma neuro 2 a cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com Accepted 2019-JUN-12 AT 15:40 BST AT 15:40 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. The Journal of biological chemistry 2011 imex curation Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com Accepted 2019-JUN-12 AT 15:40 BST AT 15:40 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. The Journal of biological chemistry 2011 imex curation Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com Accepted 2019-JUN-12 AT 15:40 BST AT 15:40 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. CXCR7/CXCR4 heterodimer constitutively recruits beta-arrestin to enhance cell migration. The Journal of biological chemistry 2011 imex curation Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Décaillot FM., Kazmi MA., Lin Y., Ray-Saha S., Sakmar TP., Sachdev P. The authors have stated that these tagged constructs are of Human origin:-FLAG-tagged CXCR7, C9-tagged CXCR4, eGFP-tagged beta-arrestin1 (Barr-GFP), HA-tagged CXCR4. sakmar@rockefeller.edu,Pallavi_Sachdev@eisai.com Accepted 2019-JUN-12 AT 15:40 BST AT 15:40 BST by PPORRAS The Journal of biological chemistry 2011 Only protein-protein interactions imex curation imex curation cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK A863EC1AFB5B158B arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR DIP protein P49407 original sequence version: 138 DIP protein P49407 original sequence version: 69 DIP protein P49407 original sequence version: 92 DIP protein P49407 original sequence version: 103 0A3C135092338D10 ackr3-cxcr4-9 2 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c9-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1A ackr3-cxcr4-10 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c9-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1B ackr3-cxcr4-11 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c9-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 1C Immunofluorescence studies of CXCR4-C9 and CXCR7-FLAG performed in Neuro2A cells co-expressing both receptors revealed co-localization of the two receptors on the cell surface as well as distinct puncta within the cell (Fig. 1C). Co-localization of the two receptors was observed on the cell surface as well as distinct puncta within the cell . ackr3-cxcr4-12 4 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2A/B/C co-expression of CXCR4 and CXCR7 resulted in a dramatic increase in both basal and SDF-1-induced beta-arrestin co-immunoprecipitation with CXCR7 Co-expression of CXCR4 and CXCR7 resulted in a dramatic increase in both basal and SDF-1-induced beta-arrestin co-immunoprecipitation with CXCR7. CXCL12 (SDF-1) treatment in presence of transfected CXCR4. ackr3-cxcr4-14 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c9-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 2D Immunofluorescence studies of CXCR4-C9 and CXCR7-FLAG performed in Neuro2A cells co-expressing both receptors revealed co-localization of the two receptors on the cell surface as well as distinct puncta within the cell (Fig. 1C). Co-localization of the two receptors was observed on the cell surface as well as distinct puncta within the cell . assuming gfp tagged protein detected by Tag Fluorescence as I can find no mention of an anti-GFP antibody being used.