IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of aryl hydrocarbon receptor interacting protein (AIP) mutations in familial isolated pituitary adenoma families. Characterization of aryl hydrocarbon receptor interacting protein (AIP) mutations in familial isolated pituitary adenoma families. Human mutation 2010 imex curation Igreja S., Chahal HS., King P., Bolger GB., Srirangalingam U., Guasti L., Guasti L., Chapple JP., Trivellin G., Gueorguiev M., Guegan K., Stals K., Khoo B., Kumar AV., Ellard S., Grossman AB., Korbonits M., null null. Rare diseases - Interactions investigated in the context of Rare genetic disease m.korbonits@qmul.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Igreja S., Chahal HS., King P., Bolger GB., Srirangalingam U., Guasti L., Guasti L., Chapple JP., Trivellin G., Gueorguiev M., Guegan K., Stals K., Khoo B., Kumar AV., Ellard S., Grossman AB., Korbonits M., null null. Rare diseases - Interactions investigated in the context of Rare genetic disease PDE4A5 and AIP constructs were found to be of rat (pmid:12810716) and human (pmid:18484068) origin respectively. m.korbonits@qmul.ac.uk Accepted 2019-NOV-19 AT 16:43 GMT AT 16:43 GMT by MGT Human mutation 2010 Only protein-protein interactions imex curation imex curation pde4a_rat cAMP-specific 3',5'-cyclic phosphodiesterase 4A Pde4a DPDE2 protein protein rat Rattus norvegicus (Rat) Rat MEPPAAPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYPDSAERSETERSPHRPIERADAVDTGDRPGLRTTRMSWPSSFHGTGTGGGSSRRLEAENGPTPSPGRSPLDSQASPGLVLHAGATTSQRRESFLYRSDSDYDMSPKAVSRSSSVASEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPIPSNKRSPLGGPPSVCKATLSEETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNEVEIPSPTPRQRAFQQPPPSVLRQSQPMSQITGLKKLVHTGSLNTNVPRFGVKTDQEDLLAQELENLSKWGLNIFCVSEYAGGRSLSCIMYTIFQERDLLKKFHIPVDTMMMYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPPLEEEPGGLGHPSLPDKFQFELTLEEEEEEDSLEVPGLPTTEETFLAAEDARAQAVDWSKVKGPSTTVVEVAERLKQETASAYGAPQESMEAVGCSFSPGTPILPDVRTLSSSEEAPGLLGLPSTAAEVEAPRDHLAATRACSACSGTSGDNSAIISAPGRWGSGGDPA 1A5F5101E4DBF1B6 aip_human AH receptor-interacting protein Aryl-hydrocarbon receptor-interacting protein Immunophilin homolog ARA9 HBV X-associated protein 2 AIP XAP2 protein protein human Homo sapiens Human MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFSH DIP protein O00170 original sequence version: 99 9302AA6D0F8D8F51 aip-pde4a-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain QQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFSH O00170:p.Arg16His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 16:25:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg16His' O00170:p.Val49Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 19:52:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val49Met' O00170:p.Lys103Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R Tue Jun 30 19:13:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys103Arg' O00170:p.Cys238Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 16:35:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys238Tyr' O00170:p.Lys241Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 19:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys241Glu' O00170:p.Arg271Trp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R W Tue Jun 30 19:20:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg271Trp' O00170:p.Ala299Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 17:38:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala299Val' O00170:p.Arg304Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 19:40:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg304Gln' O00170:p.Ile257Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 18:36:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile257Val' 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Figure 4a