UniProt UniProt http://www.uniprot.org Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Huang X., Dementiev A., Olson ST., Gettins PG. Changes in reactivity of mutated protein to iodoacetamido-N,N′-dimethyl-N-(acetyl)-N′-(7-nitrobenz-3-oxa-1,3-diazol-4-yl)ethylenediamine (NBD) on PROZ binding was monitored. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity techniques affinity technology affinity techniques predetermined predetermined participant predetermined Huang X., Dementiev A., Olson ST., Gettins PG. I've not done this as an enzyme assay, as that would not reflect what was actually being measured here which results in a Kd not a Km. For that reason, I've not tried to capture everything they are claiming but kept it simple. Binding of inhibitor to enzyme was allowed sufficient time to reach maximal inhibition, based on measured second order association rate constants. Aliquots of the complex were then diluted into an artificial fluorogenic substrate. Complex dissociation was calculated from increases in absorbance or fluorescence and dissociation rate constants were obtained by fitting progress curves to a parabolic function. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Huang X., Dementiev A., Olson ST., Gettins PG. Mutated protein tagged with iodoacetamido-N,N′-dimethyl-N-(acetyl)-N′-(7-nitrobenz-3-oxa-1,3-diazol-4-yl)ethylenediamine (NBD). Change in fluorescence on PROZ binding was monitored. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. Basis for the specificity and activation of the serpin protein Z-dependent proteinase inhibitor (ZPI) as an inhibitor of membrane-associated factor Xa. The Journal of biological chemistry 2010 imex curation Huang X., Dementiev A., Olson ST., Gettins PG. pgettins@uic.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity techniques affinity technology affinity techniques predetermined predetermined participant predetermined Huang X., Dementiev A., Olson ST., Gettins PG. Synthetic phospholipid vesicles consisting of a mixture of 70% dioleoylphosphatidylcholine and 30% dioleoylphosphatidylserine were prepared. Binding to vesicle bound-PROZ was measured by changes in scattered light intensity. PROZ binding to the vesicles was Calcium dependent. pgettins@uic.edu Accepted 2020-APR-20 AT 08:32 BST AT 08:32 BST by MGT The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fa10_human Coagulation factor X Stuart factor Stuart-Prower factor F10 protein protein human Homo sapiens Human MGRPLHLVLLSASLAGLLLLGESLFIRREQANNILARVTRANSFLEEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK DIP protein P00742 original sequence version: 131 F81D5746AF4797AF proz_human Vitamin K-dependent protein Z PROZ protein protein human Homo sapiens Human MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN 7EBD2DCC48860268 p03951-pro_0000027826 Coagulation factor XIa light chain F11 Plasma thromboplastin antecedent protein protein human Homo sapiens Human IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV 388 625 2B7C0CBE57FF358B zpi_human Protein Z-dependent protease inhibitor SERPINA10 ZPI Serpin A10 UNQ707/PRO1358 protein protein human Homo sapiens Human MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL 06BD47C97BBDD700 p03951-pro_0000027825 Coagulation factor XIa heavy chain F11 Plasma thromboplastin antecedent protein protein human Homo sapiens Human ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR 19 387 B6061E1438283783 proz-serpina10-1 2 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Supp. Table 1 proz-serpina10-2 4 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified Q9UK55:p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Glu404Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain DK AA certain certain sequence position certain certain certain sequence position certain E A Mon Dec 16 10:37:33 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259Ala;Lys260Ala;Asp404Ala]' Tue Jun 30 16:33:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Glu404Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UK55:p.[Glu334Ala;Glu404Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 16:18:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu334Ala;Glu404Ala]' Q9UK55:p.Glu334Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 18:01:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu334Ala' Q9UK55:p.Glu404Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 18:36:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu404Ala' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 2 f10-serpina10-1 3 7 unspecified role unspecified role neutral component neutral component purified purified 10 unspecified role unspecified role neutral component neutral component purified purified Q9UK55:p.Glu334Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 16:13:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu334Ala' Q9UK55:p.Glu404Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 18:37:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu404Ala' Q9UK55:p.[Glu334Ala;Glu404Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 16:53:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu334Ala;Glu404Ala]' Q9UK55:p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Asp314Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain DK AA certain certain sequence position certain certain certain sequence position certain D A Mon Dec 16 11:30:33 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259Ala;Lys260Ala;Asp314Ala]' Tue Jun 30 20:15:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Asp314Ala]' Q9UK55:p.Tyr408Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y R Tue Jun 30 19:04:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr408Arg' direct interaction direct interaction Table 1-3, Figs. 5, 8 In the presence of PROZ, lipid, and Ca2+ cofactors, there was a 10-fold reduction in F10-SERPINA10 binding for the F10 p.Glu334Ala mutant but the Glu404Ala mutant still had no effect. proz-serpina10-3 6 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified Q9UK55:p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Glu404Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain DK AA certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain D A Mon Dec 16 10:50:06 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259Ala;Lys260Ala;Asp404Ala]' Tue Jun 30 18:55:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp95Ala;Asp259_Lys260delinsAlaAla;Glu404Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 3 proz-serpina10-4 5 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UK55:p.Leu402Cys mutation mutation certain certain sequence position certain certain certain sequence position certain L C Tue Jun 30 20:13:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu402Cys' fluorescence tagged residue fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 6A proz-serpina10-5 5 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UK55:p.Ser143Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Tue Jun 30 19:56:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser143Cys' fluorescence tagged residue fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 6B proz-serpina10-6 1 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UK55:p.Leu402Cys mutation mutation certain certain sequence position certain certain certain sequence position certain L C Tue Jun 30 18:03:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu402Cys' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 7 proz-serpina10-7 1 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-plasma homo sapiens blood plasma plasma blood plasma 10 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UK55:p.Ser143Cys mutation mutation certain certain sequence position certain certain certain sequence position certain S C Tue Jun 30 19:53:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser143Cys' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction Fig. 7 f10-serpina10-2 4 7 unspecified role unspecified role neutral component neutral component purified purified 10 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Fig. 8 f11-serpina10-1 3 9 unspecified role unspecified role unspecified role unspecified role purified purified heavy chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component purified purified light chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component purified purified Q9UK55:p.Tyr408Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y R Tue Jun 30 16:54:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr408Arg' 71 73 physical association physical association Table 2 Carried out in the absence of cofactors.