IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The IL-27 p28 subunit binds cytokine-like factor 1 to form a cytokine regulating NK and T cell activities requiring IL-6R for signaling. The IL-27 p28 subunit binds cytokine-like factor 1 to form a cytokine regulating NK and T cell activities requiring IL-6R for signaling. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Crabé S., Guay-Giroux A., Tormo AJ., Duluc D., Lissilaa R., Guilhot F., Mavoungou-Bigouagou U., Lefouili F., Cognet I., Ferlin W., Elson G., Jeannin P., Gauchat JF. p28 is the alpha subunit of IL27. Protein C tag has been entered as a "Tag" with the EDQVDPRLIDGK sequence in the Sequence BOX;it could also be entered as a Mutation. jf.gauchat@umontreal.ca 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Crabé S., Guay-Giroux A., Tormo AJ., Duluc D., Lissilaa R., Guilhot F., Mavoungou-Bigouagou U., Lefouili F., Cognet I., Ferlin W., Elson G., Jeannin P., Gauchat JF. p28 is the alpha subunit of IL27. Protein C tag has been entered as a "Tag" with the EDQVDPRLIDGK sequence in the Sequence BOX;it could also be entered as a Mutation. jf.gauchat@umontreal.ca Accepted 2020-JAN-21 AT 09:06 GMT AT 09:06 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation The IL-27 p28 subunit binds cytokine-like factor 1 to form a cytokine regulating NK and T cell activities requiring IL-6R for signaling. The IL-27 p28 subunit binds cytokine-like factor 1 to form a cytokine regulating NK and T cell activities requiring IL-6R for signaling. Journal of immunology (Baltimore, Md. : 1950) 2009 imex curation Crabé S., Guay-Giroux A., Tormo AJ., Duluc D., Lissilaa R., Guilhot F., Mavoungou-Bigouagou U., Lefouili F., Cognet I., Ferlin W., Elson G., Jeannin P., Gauchat JF. p28 is the alpha subunit of IL27. Protein C tag has been entered as a "Tag" with the EDQVDPRLIDGK sequence in the Sequence BOX;it could also be entered as a Mutation. jf.gauchat@umontreal.ca 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-dendritic cell Mouse dendritic cell dendritic_cell dendritic cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Crabé S., Guay-Giroux A., Tormo AJ., Duluc D., Lissilaa R., Guilhot F., Mavoungou-Bigouagou U., Lefouili F., Cognet I., Ferlin W., Elson G., Jeannin P., Gauchat JF. p28 is the alpha subunit of IL27. Protein C tag has been entered as a "Tag" with the EDQVDPRLIDGK sequence in the Sequence BOX;it could also be entered as a Mutation. Bone marrow cells were cultured in the presence of granulocyte-macrophage colony-stimulating factor (GM-CSF) and a DC population was isolated by gradient centrifugation with Nycodenz. jf.gauchat@umontreal.ca Accepted 2020-JAN-21 AT 09:06 GMT AT 09:06 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation il27a_human Interleukin-27 subunit alpha Interleukin-30 p28 IL27 IL27A IL30 protein protein human Homo sapiens Human MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP DIP protein Q8NEV9 original sequence version: 52 crlf1_mouse Cytokine receptor-like factor 1 Crlf1 Crlm3 Cytokine receptor-like molecule 3 Cytokine-like factor 1 Novel cytokine receptor 6 protein protein mouse Mus musculus Mouse MPAGRPGPVAQSARRPPRPLSSLWSPLLLCVLGVPRGGSGAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG mint 910535C629CA7056 crlf1_human Cytokine receptor-like factor 1 CRLF1 Cytokine-like factor 1 ZcytoR5 UNQ288/PRO327 protein protein human Homo sapiens Human MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR DIP protein O75462 original sequence version: 131 il27a_mouse Interleukin-27 subunit alpha Il27 Il27a p28 protein protein mouse Mus musculus Mouse MGQVTGDLGWRLSLLLLPLLLVQAGSWGFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS il27-crlf1-1 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed protein_C_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1A When culture medium from transfectants coexpressing epitope-tagged deriva-tives of human p28 (p28-protC) and CLF (CLF-FLAG) were im-munoprecipitated with beads coupled to an anti-protein C mAb(recognizing the p28 tag) and the purified fractions assayed byWestern blot, the CLF-FLAG protein was reproducibly detected(Fig. 1A). il27-crlf1-2 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed protein_C_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1A crlf1-il27-1 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1D LPS:lipopolysaccharide -CHEBI:16412 When immature or mature DC were lysed and subjected to immunoprecipitation with an anti-CLF Ab, a p28 signal was detected by Western blot in the purified fractions (Fig. 1D).