IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel missense mutation causing abnormal LMAN1 in a Japanese patient with combined deficiency of factor V and factor VIII. A novel missense mutation causing abnormal LMAN1 in a Japanese patient with combined deficiency of factor V and factor VIII. American journal of hematology 2009 imex curation Yamada T., Fujimori Y., Suzuki A., Miyawaki Y., Takagi A., Murate T., Sano M., Matsushita T., Saito H., Kojima T. kojima@met.nagoya-u.ac.jp 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Yamada T., Fujimori Y., Suzuki A., Miyawaki Y., Takagi A., Murate T., Sano M., Matsushita T., Saito H., Kojima T. kojima@met.nagoya-u.ac.jp Accepted 2019-SEP-27 AT 10:30 BST AT 10:30 BST by ORCHARD American journal of hematology 2009 Only protein-protein interactions imex curation imex curation A novel missense mutation causing abnormal LMAN1 in a Japanese patient with combined deficiency of factor V and factor VIII. A novel missense mutation causing abnormal LMAN1 in a Japanese patient with combined deficiency of factor V and factor VIII. American journal of hematology 2009 imex curation Yamada T., Fujimori Y., Suzuki A., Miyawaki Y., Takagi A., Murate T., Sano M., Matsushita T., Saito H., Kojima T. kojima@met.nagoya-u.ac.jp 03-Oct-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-lymphoblast Homo sapiens, lymphoblast lymphoblast Transformed lymphocytes; Blast cell; Lymphoblastoid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yamada T., Fujimori Y., Suzuki A., Miyawaki Y., Takagi A., Murate T., Sano M., Matsushita T., Saito H., Kojima T. kojima@met.nagoya-u.ac.jp Accepted 2019-SEP-27 AT 10:30 BST AT 10:30 BST by ORCHARD American journal of hematology 2009 Only protein-protein interactions imex curation imex curation lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF DIP protein P49257 original sequence version: 110 B87EF117C0CD386C mcfd2_human Multiple coagulation factor deficiency protein 2 SDNSF Neural stem cell-derived neuronal survival protein MCFD2 protein protein human Homo sapiens Human MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ DIP protein Q8NI22 original sequence version: 77 EF3F3B28E5C7A8A8 d-mannose D-mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lman1-mcfd2-10 2 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level P49257:p.Trp67Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W S Tue Jun 30 18:40:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp67Ser' physical association physical association Figure 3 Ca2+ lman1-mannose-1 1 5 unspecified role unspecified role bait bait purified purified 3 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P49257:p.Trp67Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W S Tue Jun 30 15:40:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp67Ser' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 direct interaction direct interaction Figure 4