IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H was incubated with either mCRP or pCRP in solution and then added to phosphocholine-coated Maxisorp microtiter wells. Complexes were eluted, separated by SDS-PAGE, transferred to a membrane and Factor H was detected by western blotting. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mihlan M., Stippa S., Józsi M., Zipfel PF. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Mihlan M., Stippa S., Józsi M., Zipfel PF. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Mihlan M., Stippa S., Józsi M., Zipfel PF. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column antibody detection identification by antibody antibody detection Mihlan M., Stippa S., Józsi M., Zipfel PF. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Monomeric CRP contributes to complement control in fluid phase and on cellular surfaces and increases phagocytosis by recruiting factor H. Cell death and differentiation 2009 imex curation Mihlan M., Stippa S., Józsi M., Zipfel PF. Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Mihlan M., Stippa S., Józsi M., Zipfel PF. CRP is composed of five identical subunits that are stabilized by calcium ions. This 125-kDa pentameric form (pCRP) is modified on calcium depletion, heat or urea treatment and dissociates into monomeric units of 23 kDa, termed monomeric CRP (mCRP). Factor H deletion constructs-Ref 38 states:-All recombinant proteins were expressed in baculovirus-infected insect cells as secreted, histidine-tagged proteins. CRP:- expressed-ins could be either ascites fliud OR E.coli - not specified. Details of the "Recombinant mutant Factor H proteins, with single amino acid residues exchanges in SCR 20" were found in pmid:16338962-earlier work from authors of stated reference 39. peter.zipfel@hki-jena.de Accepted 2019-OCT-07 AT 13:11 BST AT 13:11 BST by ORCHARD Cell death and differentiation 2009 Only protein-protein interactions imex curation imex curation cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE p01024-pro_0000005911 Complement C3b alpha' chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN 749 1663 1E32EA0CEA20EA81 heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphocholine phosphocholine Choline phosphate ChoP N-Trimethyl-2-aminoethylphosphonate O-Phosphocholine O-phosphocholine PHOSPHOCHOLINE Phosphocholine Phosphoryl-choline Phosphorylcholine Trimethyl(2-(phosphonooxy)ethyl)ammonium N,N,N-trimethyl-2-(phosphonooxy)ethanaminium small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cfai_human Complement factor I CFI IF C3B/C4B inactivator protein protein human Homo sapiens Human MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV F06070EFE6B572A1 crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 p01024-pro_0000005908 Complement C3 beta chain C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAA 23 667 C4754001F1A97259 cfh-crp-5 7 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction 1B Polymeric CRP (pCRP) did not, but monomeric CRP (mCRP) did, bind to immobilized Factor H. pCRP did not, but mCRP did, bind to immobilized Factor H cfh-crp-6 7 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified scr/sushi_domains 1-7 sufficient to bind sufficient binding region sufficient to bind range range range range scr/sushi_domains 8-11 sufficient to bind sufficient binding region sufficient to bind range range range range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 11-15 sufficient to bind sufficient binding region sufficient to bind range range range range scr/sushi_domains 19-20 sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 1A/C, Supp. Figure 4B weak binding Ca2+ cfh-crp-7 7 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified scr/sushi_domains 1-7 sufficient to bind sufficient binding region sufficient to bind range range range range scr/sushi_domains 8-11 sufficient to bind sufficient binding region sufficient to bind range range range range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 11-15 sufficient to bind sufficient binding region sufficient to bind range range range range scr/sushi_domains 19-20 sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 1B/D cfh-crp-8 3 13 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction 2B cfh-crp-9 7 13 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 15-20 sufficient to bind sufficient binding region sufficient to bind range range range range P08603:p.[Arg1203Glu;Arg1206Glu;Arg1210Ser;Lys1230Ser;Arg1231Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R S certain certain sequence position certain certain certain sequence position certain K S certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 18:07:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg1203Glu;Arg1206Glu;Arg1210Ser;Lys1230Ser;Arg1231Ala]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Figure 2C all the single mutants are on the 8-20 SCR construct - I have not entered separately as I have assumed results will be same as for 15-20 + HepG mutant. crp-cfh-4 3 13 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 15-20 sufficient to bind sufficient binding region sufficient to bind range range range range scr/sushi_domains 19-20 required to bind necessary binding region required to bind range range range range P08603:p.[Arg1203Glu;Arg1206Glu;Arg1210Ser;Lys1230Ser;Arg1231Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R S certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain K S certain certain sequence position certain certain certain sequence position certain R A Wed Nov 13 14:58:19 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg1203Glu;Arg1206Glu;Arg1210Ser; Lys1230Ser;Arg1231Ala]' Tue Jun 30 19:24:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg1203Glu;Arg1206Glu;Arg1210Ser;Lys1230Ser;Arg1231Ala]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 2B cfh-crp-10 7 13 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction Figure 2C phosphocholine-cfh-1 2 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum physical association physical association 5 crp-cfh-5 5 12 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum 9 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 13 stimulator stimulator neutral component neutral component purified purified 8 cofactor cofactor coenzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Figure 6 C/D Lanes 5-7, Supp. fig 5A C3b (as supplied by Merck) is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. c3-cfh-18 5 12 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum 9 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 8 cofactor cofactor coenzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Figure 6 C3b (as supplied by Merck) is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. crp-cfh-6 6 13 unspecified role unspecified role neutral component neutral component purified purified physical association physical association Supplementary figure 1 crp-cfh-7 7 70 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum physical association physical association Supp. Figure 3 cfh-crp-11 7 10 inhibitor inhibitor unspecified role unspecified role 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 15-20 sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Figure 4B weak binding heparin partially inhibited binding of Factor H deletion constructs to pCRP. Heparin partially inhibited binding of Factor H deletion constructs to pCRP. cfh-crp-12 7 10 inhibitor inhibitor unspecified role unspecified role 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 15-20 sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp. Figure 4C Binding of mCRP to Factor H and Factor H deletion constructs was reduced significantly. cfh-crp-13 7 10 inhibitor inhibitor unspecified role unspecified role 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum physical association physical association Supp. Figure 4C Binding of mCRP to Factor H and Factor H deletion constructs was reduced significantly. Binding of mCRP to Factor H and Factor H deletion constructs was reduced significantly c3-cfh-19 4 12 enzyme enzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum 9 enzyme target enzyme target substrate substrate neutral component neutral component purified purified human-serum Homo sapiens serum Serum 13 stimulator stimulator neutral component neutral component purified purified 8 cofactor cofactor coenzyme neutral component neutral component purified purified human-serum Homo sapiens serum Serum protein cleavage protein cleavage Supp. fig 5B C3b (as supplied by Merck) is a complex composed of the modified C3-alpha chain (a') (M.W. 105,000) and the intact C3-beta chain (M.W. 75,000). Factor I cleaves the a' chain of the C3b complex. cfh-crp-14 7 13 unspecified role unspecified role prey prey purified purified 8 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 15-20 sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Supplementary figure 4A NaCl concentration of 560 mM, using Factor H deletion construct SCRs 15-20. crp-cfh-8 7 13 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range scr/sushi_domains 8-20 sufficient to bind sufficient binding region sufficient to bind range range range range P08603:p.Trp1183Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W L Tue Jun 30 17:44:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1183Leu' P08603:p.Val1197Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 16:14:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1197Ala' P08603:p.Arg1210Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 18:02:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1210Cys' P08603:p.Arg1215Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R G Tue Jun 30 18:17:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1215Gly' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Figure 2C-2_single_mutants all the single mutants are on the 8-20 SCR construct - I have not entered separately as I have assumed results will be same as for 15-20 + HepG mutant. c3b_human Complement C3b complex C3b dimer 9 unspecified role unspecified role C3 beta chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role C3b alpha(prime) chain binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 108 110 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A protein complex of the alternative pathway of complement activation of the innate immune system. Complement C3 precurser is activated by cleavage into C3a and C3b by C3 convertases, either C4bC2a in the classical and lectin pathways or C3(H2O)Bb, C3bBb, C3bBbC3b, C3bBbP or C3bBbC3bP in the alternative pathway. C3b acts as an opsonin and interacts with glycoproteins and carbohydrates on pathogenic or apoptotic target cell surfaces through its reactive thioester moiety. Opsonization of target cells leads to enhanced phagocytosis, lysis of target cells via membrane attack complex (CPX-6159) assembly, clearance of antibody-antigen complexes and up-regulation of the adaptive response. Activation of C3b leads to an amplification cascade that generates more C3 convertase, deposits more C3b at the local site and switches C3 convertases to C5 convertases. To protect host cells from inadvertent complement activation the activation of C3b is tightly regulated by either disrupting the C3 convertases or aiding in the proteolytic degradation of C3b. Bacteria and viruses possess C3b proteases to evade the complement response. Lack of protection, due to familial mutations in the complement genes or the presence of autoantibodies against regulators has been linked to atypical hemolytic uremic syndrome (aHUS) and C3 glomerulopathies (C3G) in kidneys and age-related macular degeneration (AMD) in eyes. Conditions of chronic and acute inflammations, as in rheumatoid arthritis, strokes, and heart attacks, become aggravated by complement activation against the disturbed tissue. The alternative pathway is continuously activated at a low level. C3 precursor is first processed by the removal of 4 Arg residues and spontaneous hydrolysis due to the breakdown of the internal thioester bond forms C3(H2O) (disulfide bonded P01024-PRO_0000005909 & P01024-PRO_0000005908). C3(H2O) subsequently binds factor B that is cleaved by Factor D (P00746) into 2 fragments: CFBa and CFBb. CFBb, a serine protease, then combines with complement factor C3(H2O) or C3b to generate the C3 or C5 convertases. Proteolytic cleavage of C3 to C3b is accompanied by large conformational changes that result in the exposure of cryptic binding sites required for convertase assembly and regulation. This includes a significant movement of the thioester-bond-containing domain through which C3b attaches to target surfaces. Heterodimer Complement component 3 (C3) deficiency [Orphanet:280133]: a rare, autosomal recessive defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Atypical hemolytic-uremic syndrome with C3 anomaly [Orphanet:2134 & Orphanet:93575]: an autosomal dominant, atypical form of hemolytic-uremic syndrome (aHUS, a thrombotic microangiopathy) characterized by mechanical hemolytic anemia, thrombocytopenia, and renal dysfunction. Age-related macular degeneration [EFO:0001365]: age-related macular degeneration usually in older adults which results in a loss of vision in the center of the visual field (the macula lutea) because of damage to the retina. Manifests as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. Occurs in dry and wet forms. Most common cause of irreversible vision loss in the developed world. Accepted 2017-JAN-19 by ORCHARD coronavirus