IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. The EMBO journal 2007 imex curation Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu Accepted 2021-APR-27 AT 08:51 BST AT 08:51 BST by PPORRAS The EMBO journal 2007 Only protein-protein interactions imex curation imex curation Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. The EMBO journal 2007 imex curation Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu Accepted 2021-APR-27 AT 08:51 BST AT 08:51 BST by PPORRAS The EMBO journal 2007 Only protein-protein interactions imex curation imex curation Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. The EMBO journal 2007 imex curation Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu Accepted 2021-APR-27 AT 08:51 BST AT 08:51 BST by PPORRAS The EMBO journal 2007 Only protein-protein interactions imex curation imex curation xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM DIP protein P23025 original sequence version: 75 DIP protein P23025 original sequence version: 116 F89F735219A8494B ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP DIP protein P07992 original sequence version: 109 DIP protein P07992 original sequence version: 69 DIP protein P07992 original sequence version: 162 6FCE3615732349E5 ercc1-xpa-1 1 5 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13C radiolabelled 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15N radiolabelled 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 4 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13C radiolabelled 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15N radiolabelled 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 12 direct interaction direct interaction Figs.1, 2 and 3 ercc1-xpa-4 2 5 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 4 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 17 19 direct interaction direct interaction Fig.S1A and B ercc1-xpa-5 3 5 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 4 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobd Escherichia coli (strain B / BL21-DE3) 22 24 direct interaction direct interaction Fig.S1C