UniProt UniProt http://www.uniprot.org Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 imex curation Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret antibody detection identification by antibody antibody detection Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease A FRET-variation, FLIM, for detecting intermolecular or intramolecular interactions that take place within a distance of 10nm or less Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org Accepted 2019-JUN-21 AT 07:47 BST AT 07:47 BST by MGT The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Only protein-protein interactions imex curation imex curation Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 imex curation Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret antibody detection identification by antibody antibody detection Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease A FRET-variation, FLIM, for detecting intermolecular or intramolecular interactions that take place within a distance of 10nm or less Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org Accepted 2019-JUN-21 AT 07:47 BST AT 07:47 BST by MGT The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Only protein-protein interactions imex curation imex curation Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 imex curation Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org Accepted 2019-JUN-21 AT 07:47 BST AT 07:47 BST by MGT The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Only protein-protein interactions imex curation imex curation Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 imex curation Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org Accepted 2019-JUN-21 AT 07:47 BST AT 07:47 BST by MGT The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Only protein-protein interactions imex curation imex curation Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme. The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 imex curation Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Spoelgen R., von Arnim CA., Thomas AV., Peltan ID., Koker M., Deng A., Irizarry MC., Andersen OM., Willnow TE., Hyman BT. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of APP inferred from mutant mapping. Interactions involving endogenous BACE could not be curated as this could not be mapped to a single gene product. source of BACE1 construct described in PMID:15466887 bhyman@partners.org Accepted 2019-JUN-21 AT 07:47 BST AT 07:47 BST by MGT The Journal of neuroscience : the official journal of the Society for Neuroscience 2006 Only protein-protein interactions imex curation imex curation p05067-pro_0000000091 C99 APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 672 770 1557A769890AF8E4 a4_mouse Amyloid-beta precursor protein App Alzheimer disease amyloid A4 protein homolog ABPP Amyloidogenic glycoprotein Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein mouse Mus musculus Mouse MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 988D89E089092A3E sorl_mouse Sortilin-related receptor Sorl1 Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats Gp250 protein protein mouse Mus musculus Mouse MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQDRGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFSKISEKLNFGVGNNSEAVISQFYHSPADNKRYIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQFVTKHPINEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVFSEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAMRKSIYRYDLASGATEQLPLSGLRAAVALDFDYERNCLYWSDLALDTIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDVKWPNGISVDSQWIYWTDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKHSRSQVEILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVASSVLPSGDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQDGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCEPFCTRFMDFVCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHVLPSPTPGPSTCLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFKCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNTNDFVTLRTPEGLPDAPRNLQLSLNSEEEGVILGHWAPPVHTHGLIREYIVEYSRSGSKMWASQRAASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQAPNIHIDSYDENSLSFTLTMDGDIKVNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHRVSNLTAHTSYEISAWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNVVYGIFYATSFLDLYRNPKSVTTSLHNKTVIVSKDEQYLFLVRVLIPYQGPSSDYVVVKMIPDSRLPPRHLHAVHIGKTSALIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVRSRNSTVEYSLSKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKQFNETRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICGEPAVLLYDELSSGADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFSAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein O88307 original sequence version: 73 mint Likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. Binds the receptor-associated protein (RAP). Could play a role in cell-cell interaction. May play a role in neural organization, as well as the establishment of embryonic organ systems 5D7F53806EFE2CB0 bace1_human Beta-secretase 1 BACE KIAA1149 Beta-site amyloid precursor protein cleaving enzyme 1 Membrane-associated aspartic protease 2 Memapsin-2 Aspartyl protease 2 BACE1 protein protein human Homo sapiens Human MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK DIP protein P56817 original sequence version: 161 377CE4C824ACEF05 377CE4C824ACEF05 sorl_human Sortilin-related receptor Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SORL1 C11orf32 protein protein human Homo sapiens Human MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein Q92673 original sequence version: 154 4C215BB33E65C0B2 p05067-4 Amyloid-beta precursor protein APP A4 AD1 ABPP Alzheimer disease amyloid protein Cerebral vascular amyloid peptide PreA4 Protease nexin-II APPI PreA4 695 Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN DIP protein P05067-4 original sequence version: 183 DIP protein P05067-4 original sequence version: 198 DIP protein P05067-4 original sequence version: 224 A major isoform. 4F6EA0139F969D56 app-sorl1-5 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P05067-PRO_0000000091:p.[Tyr86Ala;Tyr91Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Fri Feb 01 16:27:40 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr86Ala;Tyr92Ala]' Tue Jun 30 15:49:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr86Ala;Tyr91Ala]' physical association physical association Fig. 4 To analyze whether sorLA and C99 bind to each other, extracts from C99-myc and sorLA-transfected N2a cells were pulled down with myc-binding beads and probed with rabbit anti- sorLA and mouse 9E10 anti-myc antibody. app-sorl1-8 4 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3 app-sorl1-9 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain proximity proximity close-contact colocalization neighbourhood interaction Fig. 5, Table 1 First, we analyzed the proximity of the intracellular domains of APP and sorLA by FLIM. app-sorl1-10 1 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction Fig. 6, Table 2 app-bace1-5 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 8, Table 3 SORL1 (Q92673) The interaction of BACE and APP was dramatically reduced in the presence of SORL1 app-sorl1-12 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization Fig. 3 app-sorl1-13 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction Fig. 5B First, we analyzed the proximity of the intracellular domains of APP and sorLA by FLIM.