IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Group 13 HOX proteins interact with the MH2 domain of R-Smads and modulate Smad transcriptional activation functions independent of HOX DNA-binding capability. Group 13 HOX proteins interact with the MH2 domain of R-Smads and modulate Smad transcriptional activation functions independent of HOX DNA-binding capability. Nucleic acids research 2004 imex curation Williams TM., Williams ME., Heaton JH., Gelehrter TD., Innis JW. Coip experiment with ALK3 as an interactor was not captured as the origin of this construct was not known innis@umich.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Williams TM., Williams ME., Heaton JH., Gelehrter TD., Innis JW. Coip experiment with ALK3 as an interactor was not captured as the origin of this construct was not known innis@umich.edu Accepted 2019-MAY-30 AT 10:11 BST AT 10:11 BST by PPORRAS cDNA library of mouse embryos (C57BL/6J) Nucleic acids research 2004 Only protein-protein interactions imex curation imex curation Sufficient to bind - corrected; tags and orientations added for baits and preys; Figure legend - removed; tags and orientations added for baits and preys Group 13 HOX proteins interact with the MH2 domain of R-Smads and modulate Smad transcriptional activation functions independent of HOX DNA-binding capability. Group 13 HOX proteins interact with the MH2 domain of R-Smads and modulate Smad transcriptional activation functions independent of HOX DNA-binding capability. Nucleic acids research 2004 imex curation Williams TM., Williams ME., Heaton JH., Gelehrter TD., Innis JW. Coip experiment with ALK3 as an interactor was not captured as the origin of this construct was not known innis@umich.edu 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Williams TM., Williams ME., Heaton JH., Gelehrter TD., Innis JW. Coip experiment with ALK3 as an interactor was not captured as the origin of this construct was not known innis@umich.edu Accepted 2019-MAY-30 AT 10:11 BST AT 10:11 BST by PPORRAS Nucleic acids research 2004 Only protein-protein interactions imex curation imex curation Sufficient to bind - corrected; tags and orientations added for baits and preys; Figure legend - removed; tags and orientations added for baits and preys hxd13_mouse Homeobox protein Hox-D13 Hoxd13 Hox-4.8 Homeobox protein Hox-4.8 protein protein mouse Mus musculus Mouse MSRSGTWDMDGLRADGGAAGAAPASSSSSVAAPGQCRGFLSAPVFAGTHSGRAAAAAAAAAAAAAAASSFAYPGTSERTGSSSSSSSSAVIATRPEAPVAKECPAPAAAATAAAPPGAPALGYGYHFGNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYMDVSGLASSSVPTNEVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCAKDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVKDKKIVSKLKDTVS C1BD2FAF6D56E533 hxa11_mouse Homeobox protein Hox-A11 Hoxa11 Hox-1.9 Hoxa-11 Homeobox protein Hox-1.9 protein protein mouse Mus musculus Mouse MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKNAEKGPQAAAATSAAAVAAAATGAPATSSSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL 07BE80F8E2225B3E hxa13_mouse Homeobox protein Hox-A13 Hoxa13 Hox-1.10 Homeobox protein Hox-1.10 protein protein mouse Mus musculus Mouse MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAAAAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPVPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQTQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS 2B01DCC9B1951324 smad2_mouse Mothers against decapentaplegic homolog 2 Smad2 Madh2 Madr2 Mad-related protein 2 SMAD family member 2 protein protein mouse Mus musculus Mouse MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS 31A2A36D463DB3E9 meis1_mouse Homeobox protein Meis1 Myeloid ecotropic viral integration site 1 Meis1 protein protein mouse Mus musculus Mouse MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM E0C32B5CE25E1E2C hxa9_mouse Homeobox protein Hox-A9 Hoxa9 Hox-1.7 Hoxa-9 Homeobox protein Hox-1.7 protein protein mouse Mus musculus Mouse MATTGALGNYYVDSFLLGADAADELGAGRYAPGTLGQPPRQAAALAEHPDFSPCSFQSKAAVFGASWNPVHAAGANAVPAAVYHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE DIP protein P09631 original sequence version: 124 C1E679D9CBF677B0 smad1_mouse Mothers against decapentaplegic homolog 1 Smad1 Madh1 Madr1 Mothers-against-DPP-related 1 Dwarfin-A SMAD family member 1 protein protein mouse Mus musculus Mouse MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQPMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS mint Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD) (By similarity). May play a role in the initiation and maintenance of spermatogenesis 07A56FBEE79A1C2A smad5_mouse Mothers against decapentaplegic homolog 5 Smad5 Madh5 Msmad5 SMAD family member 5 Dwarfin-C protein protein mouse Mus musculus Mouse MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQPMDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS mint Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD) (By similarity). Required for angiogenesis D66B638DA76BC20B hoxa13-smad5-1 1 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association hoxa13-meis1-4 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 meis1-hoxd13-1 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 hoxd13-smad5-1 2 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 hoxa11-meis1-2 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 meis1-hoxa9-1 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 hoxa13-smad5-2 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 2, Figure 3b smad5-hoxa13-1 2 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 1 smad5-hoxd13-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3b hoxa13-smad1-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3b smad1-hoxd13-1 2 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3b hoxa13-smad2-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3b smad2-hoxd13-1 2 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3b