IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. The Journal of cell biology 2003 imex curation Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp Accepted 2019-MAY-02 AT 14:24 BST AT 14:24 BST by PPORRAS The Journal of cell biology 2003 Only protein-protein interactions imex curation imex curation Two separate experiments created; Correction done: X'ref to GO term; specific partcipant detection method for CD151 CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. The Journal of cell biology 2003 imex curation Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp Accepted 2019-MAY-02 AT 14:24 BST AT 14:24 BST by PPORRAS The Journal of cell biology 2003 Only protein-protein interactions imex curation imex curation Two separate experiments created; Correction done: X'ref to GO term; specific partcipant detection method for CD151 CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. CD151 regulates epithelial cell-cell adhesion through PKC- and Cdc42-dependent actin cytoskeletal reorganization. The Journal of cell biology 2003 imex curation Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp 25-Jul-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K., Shigeta M., Sanzen N., Ozawa M., Gu J., Hasegawa H., Sekiguchi K. Origin of species of GTP-loaded Cdc42, Rac, and Rho was not provided in the reference, so interactions involving these interactors were not captured sekiguch@protein.osaka-u.ac.jp Accepted 2019-MAY-02 AT 14:24 BST AT 14:24 BST by PPORRAS The Journal of cell biology 2003 Only protein-protein interactions imex curation imex curation Two separate experiments created; Correction done: X'ref to GO term; specific partcipant detection method for CD151 ita3_human Integrin alpha-3 ITGA3 MSK18 Galactoprotein B3 VLA-3 subunit alpha FRP-2 CD49 antigen-like family member C protein protein human Homo sapiens Human MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHGNGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY EEAFA7778EF17B21 kpca_human Protein kinase C alpha type PRKCA PKCA PRKACA protein protein human Homo sapiens Human MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV 9EB157789A062349 cd151_human CD151 antigen CD151 GP27 Membrane glycoprotein SFA-1 Platelet-endothelial tetraspan antigen 3 TSPAN24 Tetraspanin-24 protein protein human Homo sapiens Human MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY 0C8FE4CF2C3C286D cd151-itga3-3 2 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1a cd151-itga3-4 1 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 1a cd151-itga3-5 3 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 1b cd151-prkca-1 3 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 6 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 7c